Стартовой аминокислотой является: Кодоны стартовые — Справочник химика 21

Содержание

Кодоны стартовые — Справочник химика 21

    Генетический код — это определенная последовательность азотистых оснований нуклеотидов данного гена, соответствующая последовательности аминокислот в белке. Каждая аминокислота кодируется тремя азотистыми основаниями, расположенными в определенной последовательности — триплетом, который называется кодоном. Большинство аминокислот, кроме метионина и триптофана, может кодироваться несколькими кодонами. Кодоны 20 аминокислот представлены в табл. 17. Указанные кодоны различаются только третьим азотистым основанием. Например, кодирование аминокислоты аланина осуществляется четырьмя триплетами нуклеотидов — ГЦУ, ГЦЦ, ГЦА, ГЦГ. Главную роль при узнавании аминокислоты играют первые два основания. Не все кодоны кодируют аминокислоты. Некоторые из них служат «стартовыми» сигналами, запускающими синтез полипептидной цепи белка, как, например, АУГ — кодон метионина. Другие кодоны, например [c.220]
    Стартовый кодон гена Uj 
[c.97]

    Триплетная природа генетического кода была впервые продемонстрирована в генетических экспериментах. Последовательность из трех нуклеотидов, соответствующая одной аминокислоте, называется кодоном. Последовательность кодонов читается непрерывно, начиная с фиксированной стартовой точки на одном конце гена, и заканчивается в точке терминации на другом конце гена. Записывая последовательность нуклеотидов условно в направлении от 5 -конца к З -концу, мы увидим, что она соответствует аминокислотной последовательности, записанной в направлении от N-конца к С-концу. [c.57]

    К. Поскольку стартовым кодоном для начала синтеза белка является [c.10]

    Из этих опытов видно, что генетический код читается как последовательность, у которой рамка считывания фиксирована наличием стартовой точки, так что одиночные вставки и делеции компенсируют друг друга. При двойных же вставках или двойных делециях мутации не компенсируются. Из этого, однако, не ясно, из скольких нуклеотидов состоит кодон. Но если сконструировать тройных мутантов, то комбинации типа (- — — — -Ь) и (—) будут иметь дикий фенотип, другие же комбинации останутся мутантными. Из этого следует, что код считывается триплетами, так как тройные вставки и тройные делеции добавляют или удаляют только по одной аминокислоте. Измененная часть белка ограничена при этом участком между первым и третьим мутационными сайтами (рис. 4.3). 

[c.58]

    Почему начинается синтез белка, т. е. как распознается первый кодон в гене, являющийся стартовой точкой при трансляции  [c.72]

    Прямое секвенирование аминокислот более утомительно и неэкономично по сравнению с определением последовательности РНК. Однако при незнании N-терминальной и С-терминальной последовательности белка всегда имеется неопределенность относительно того, действительно ли первый стартовый кодон мРНК используется для инициации синтеза этого белка или первый стоп - 

[c.116]

    Г. Поскольку в этой последовательности нет кодона AUG или GUG (который иногда используется как стартовый сигнал для трансляции у Е. соИ), она не может относиться к началу кодирующей области гена. Она могла бы относиться к концу гена, если бы использовалась первая или вторая рамка считывания, или к середине гена, если бы использовалась третья рамка считывания. Чтобы разобраться в этих возможностях, нужно иметь больше информации. [c.281]


    Образование полипептидных связей на рибосомах обычно подразделяют на три процесса инициацию, элонгацию и терминацию [98]. Синтез белка начинается с инициирующего кодоиа чаще всего им является кодон метионина AUG. Кодон GUG, расположенный надлежащим образом в цепи мРНК, также может служить инициирующим кодоном. В этом случае он детерминирует метионин, а не валин. Для распознавания стартового сигнала важную роль может играть также последовательность оснований, предшествующая инициирующему кодону. На это указывает тот факт, что кодоны AUG и GUG встречаются не только в точках инициации. 
[c.231]

    Принимая во внимание это обстоятельство, в настоящее время ГРЧ синтезируют методами генетической инженерии в специально сконструированных клетках бактерий. Будучи синтезированным в клетках Е. соИ, ГРЧ содержит дополнительный остаток метионина на НгН-конце молекулы. Биосинтез ГРЧ из 191 аминокислотного остатка бьш осуществлен в 1979 г. Д. Гедделем с сотрудниками. Сначала клонировали двунитевую кДНК далее путем расщепления получали последовательность, кодирующую аминокислотный порядок гормона, за исключением первых 23 аминокислот, — с фен (—Nh3) до лей (23), и синтетический полинуклеотид, соответствующий аминокислотам от первой до двадцать третьей со стартовым ATG-кодоном в начале. Затем два фрагмента объединяли и подстраивали к паре 1ас-промоторов и участку связывания рибосом. Конечный выход гормона составил 2,4 мкг на 1 мл культуры, что составляет 100 000 молекул гормона на клетку. Полученный гормон на конце полипептидной цепи содержал дополнительный остаток метионина и обладал значительной био- 

[c.138]

    Регулируемые терминаторы бактерий называют аттенюаторами (ослабителями). Впервые обнаружен и лучше других изучен аттенюатор триптофанового оперона Е. соИ. Этот оперон состоит из пяти генов, кодирующих ферменты биосинтеза триптофана. Регуляцию осуществляют две системы, чувствующие потребность клетки в триптофане. Первая система влияет на эффективность инициации на промоторе оперона. Репрессор триптофанового оперона в комплексе с триптофаном присоединяется к оператору, расположенному перед стартовой точкой транскрипции в районе —10 , и стерически препятствует РНК-полимеразе присоединяться к промотору. Таким образом, при избытке триптофана оперон репрессирован. В отсутствие триптофана репрессор теряет способность связываться с оператором, в результате чего оперон индуцируется. Эту систему дополняет регуляция в аттенюаторе, расгГоложенном на расстоянии 180 п. н. от стартовой точки транскрипции внутри первого структурного гена. В условиях избытка триптофана лишь одна из десяти молекул РНК-полимеразы, начавших синтез РНК на триптофановом промоторе, преодолевает этот терминатор и переходит в область структурных генов. При уменьшении количества триптофана доля молекул РНК-полимеразы, преодолевающих аттенюатор, возрастает. 

[c.158]

    DKG-peдyктaзы, и секвенировали его. Нуклеотидные последовательности, расположенные до стартового кодона ATG, вырезали и заменяли их сигналами транскрипции и трансляции, функционирующими в Е. соН, поскольку регуляторные последовательности грамположитель-ных микроорганизмов типа oryneba terium spp. не функционируют в клетках этого микроорганизма. Полученную конструкцию вводили в [c.250]

    Факторы, от которых зависит отделение завершенной полипептидной цепи от полисомы, изучены слабо. Согласно одной из предложенных моделей, это отделение происходит после того, как через участок поликонденсации пройдет кодон, соответствуюш ий С-концевому аминокислотному остатку полипептида одновременно от полисомы отделяется и рибосома, на которой произошло это событие. Для полицнстронных матриц эта простая модель, очевидно, не подходит. В этом случае должен, по-видимому, существовать какой-то сигнал, который вынуждал бы готовую полипептидную цепь отделяться от рибосомы, а рибосому — приступать к трансляции следующего цистрона с определенной стартовой точки, или же это должен быть сигнал для одновременного отделения готовой полипептидной цепи и рибосомы (несмотря на то что считана еще не вся т-РНК). В последнем случае необходим, очевидно, еще один сигнал в начале следующего цистрона, который служил бы указанием другой, присоединяющейся рибосоме, с какого места 

[c.531]

    Следующим этапом является доставка первой аминокислоты, связанной с тРНК. Стартовым сигналом в мРНК является кодон AUG (см. табл. 11.2) он же является кодоном для метионина или формилметионина. У бактерий белковая цепь начинается с формилметионина, а у животных — с метионина (см. 

[c.54]

    Рамка считывания, содержащая последовательную серию кодонов, соответствующих аминокислотной последовательности, называется открытой. До сих пор мы говорили о кодовых значениях, имея в виду открытую рамку считывания, начинающуюся с какой-то фиксированной точки. Но в чем состоит стартовый сигнал Точно так же, как нонсенс-кодоны используются для терминации белкового синтеза, другой набор кодонов служит для его запуска. Общим сигналом инициации является соответствующий метионину кодон AUG в комбинации с предшествующей ему последовательностью, нужной для прикрепления рибосом к мРНК. В некоторых случаях для инициации используется также кодон GUG, который вопреки коду транслируется как метионин, а не как ва-лин. Таким образом, кодирующая область состоит из кодона AUG (или GUG), следующей за ним серии триплетов, составляющих открытую рамку считывания, и оканчивается терминирующими кодонами UAA, UAG и UGA. 

[c.63]


    До настоящего времени только два гликопротеида — НА и NA — были изучены прямым секвенированием аминокислот. Для НА. было обнаружено, что его синтез начинается с лидер-последовательности, поскольку первые 15—18 аминокислот, ожидаемые после первого стартового кодона мРНК, не присутствуют на N-конце НА1. Дальнейшие характеристики молекулы НА, обнаруженные методом прямого секвенирования, обсуждены выше [117]. [c.117]

    Приведенный в таблице перечень не содержит регуляторных мутаций, локализующихся перед геном НЬа, однако найдена мутация, нарушающая стартовый кодон AUG. Фенотипически это изменение проявляется как а-талассемия-не образуется функциональной мРНК, поскольку AUG-кодон, с которого начинается трансляция. 

[c.97]

    На участке Тгр-промотора РНК-полимераза, свободная от контроля со стороны репрессора, начинает транскрипцию оперона и доходит до 90-го нуклеотида (рис, 41,10), где она делает временную остановку. Во время этой паузы к образовавшемуся 5 -концу лидерного транскрипта в области 27—29 стартового кодона AUG прикрепляется рибосома, происходит трансляция лидерного пептида длиной 14 аминокислот. Начиная с положения 54, в транскрипте последовательно расположены два триптофановых кодона, поэтому для продолжения трансляции необходимо присутствие тРНК » , Следует отметить, что триптофан — относительно редкая аминокислота, Еще реже два остатка триптофана располагаются друг за другом в составе полипептидов. [c.118]

    Рассмотрим более подробно участок РНК, включающий SD последовательность и стартовый кодон AUG у двух плазмид, наиболее сильно отличающихся друг от друга экспрессией гена его. На рис. 6. И. а изображен участок РНК плазмиды с наиболее высокой экспрессией его гена. Действи- 

[c.217]

    Какой пептид будет синтезироваться, если трансляция мРНК начинается точно с 5 -конца этой мРНК (Допустим, что стартовый кодон в данном случае не требуется). [c.41]

    Приведены последовательности нуклеотидов в консервативных уча стках промотора и в стартовом сайте транскрипции На мРНК. ука аны возможные инициирующие и терминирующие кодоны р — промогор t — терминатор гранскрипции > — инициирующий кодон, i — терми [c.17]

    Установлены нуклеотидные последовательности самого инвервертируемого элемента длиной 1 т. п. н. и фланкирующих его последовательностей. При этом последовательности на концах элемента были определены независимо для обеих ориентаций. Положение промотора для гена hin точно не установлено, но скорее всего ген начинается в пределах концевого повтора стартовый кодон ATG гена hin находится в пределах 100 п.н. от начала повтора. Отметим, что благодаря сходству двух концов элемента промотор hin при инверсии не разрушается. Таким образом, ген hin может экспрессироваться в любой ориентации. С помощью секвенирования установлено положение промотора оперона Н2 внутри сегмента длиной 1 т. п. н., ближе к одному из его концов. Сама кодирующая часть Н2 начинается на расстоянии 16 п.н. от инвертируемого сегмента. [c.274]

    Транспортная РНК, несущая аминокислоту Анти-кодрн спаривается со стартовым кодоном [c.195]


From DNA to Protein | Protocol (Translated to Russian)

21.12: От ДНК к белку

Поток генетической информации в клетках от ДНК к мРНК к белку описывается центральной догмой, которая гласит, что гены определяют последовательность мРНК, которая в свою очередь определяет последовательность аминокислот, образующей все белки. Декодирование одной молекулы в другую осуществляется специфическими белками и РНК. Поскольку информация, хранящаяся в ДНК, является настолько центральной для клеточной функции, интуитивно понятно, что клетка будет делать mRNA копии этой информации для синтеза белков, сохраняя при этом саму ДНК нетронутой и защищенной. Копирование ДНК на РНК относительно прямолинейно, при этом один нуклеотидный прилив добавляется в цепочку мРНК для каждого нуклеотидного прочтения в ДНК. Перевод на белок является несколько более сложным, поскольку три нуклеотидов мРНК соответствуют одной аминокислоте в полипептидной последовательности. Однако, перевод на белок все еще систематический и коллинеарный, так что нуклеотиды 1—3 соответствуют аминокислоте 1, нуклеотиды 4—6 соответствуют аминокислоте 2, и так далее.

Генетический кодекс деградирует и универсал

Каждая аминокислота определяется трёхнуклеотидной последовательностью, называемой кодоном триплета. Учитывая различное количество «букв» в «алфавитах» мРНК и белка, ученые теоретизировали, что отдельные аминокислоты должны быть представлены комбинациями нуклеотидов. Нуклеотидных дублетов было бы недостаточно, чтобы указать каждую аминокислоту, так как существует только 16 возможных двухнуклеотидных комбинаций (42). В отличие от этого, существует 64 возможных нуклеотидных триплетов (43), что намного больше, чем количество аминокислот. Ученые теоретизировали, что аминокислоты были закодированы нуклеотидными триплетами и что генетический код “вырожден”. Другими словами, данная аминокислота может быть закодирована более чем одним нуклеотидным триплетом. Позже это было подтверждено экспериментально: Фрэнсис Крик и Сидней Бреннер использовали химический мутаген-профлавик для вставки одного, двух или трех нуклеотидов в ген вируса. При вставке одного или двух нуклеотидов нормальные белки не производились. Когда были вставлены три нуклеотида, белок был синтезирован и функциональен. Это показало, что аминокислоты должны быть определены группами из трех нуклеотидов. Эти нуклеотидные триплеты называются кодонами. Введение одного или двух нуклеотидов полностью изменило рамку считывания триплета, тем самым изменив сообщение для каждой последующей аминокислоты. Несмотря на то, что введение трех нуклеотидов привело к введению дополнительной аминокислоты во время перевода, целостность остальной части белка сохранялась.

В дополнение к кодонам, которые поручают добавление специфической аминокислоты в полипептидную цепь, три из 64 кодонов прекращают синтез белка и высвобощают полипептид из переводческой машины. Эти триплеты называются чепушными кодонами или прекращают кодонами. Другой кодон, АВГ, также имеет особую функцию. Помимо указания аминокислотного метионина, он также служит в качестве стартового кодона для инициации перевода. Кадр для чтения для перевода задается кудоном AUG start около конца 5′ мРНК. После начала кодона мРНК читается группами по три человека до тех пор, пока не будет обнаружен стопный кодон.

Характеристика одной аминокислоты несколькими похожими кодонами называется «дегенерация». Считается, что дегенерация является клеточным механизмом для уменьшения негативного воздействия случайных мутаций. Кодоны, определяющие одну и ту же аминокислоту, обычно отличаются лишь на один нуклеотидный. Кроме того, аминокислоты с химически похожими боковыми цепями кодируются подобными кодонами. Например, аспартат (ASP) и глютамат (Glu), которые занимают блок GA*, оба отрицательно заряжаются. Этот нюанс генетического кода гарантирует, что однонуклеотидная замещающая мутация может указать ту же аминокислоту, но не оказывает влияния или не указывает на аналогичную аминокислоту, предотвращая превращение белка в полностью нефункциональную.

Генетический код почти универсален. За некоторыми незначительными исключениями, практически все виды используют один и тот же генетический код для синтеза белков. Сохранение кодонов означает, что очищенная мРНК, кодирующая белок глобина в лошадях, может быть перенесена в тюльпанную клетку, а тюльпан синтезирует конный глобин. То, что существует только один генетический код, является мощным доказательством того, что вся жизнь на Земле имеет общее происхождение, особенно учитывая, что существует около 1084 возможных комбинаций 20 аминокислот и 64 триплета кодонов.

Этот текст был адаптирован из Openstax, Biology 2e, Глава 15.1: Генетический кодекс.

Синтез белка — интернет энциклопедия для студентов

Содержание:

  1. Биосинтез белка в цитоплазме
  2. Аминоацилсинтетазы
  3. Процесс формирования инициирующего комплекса

Белки составляют свыше 50% от всей сухой массы клетки и по этой причине синтез белка так важен для поддержания их функций, происходящих в них процессов, роста и развития клеток. Можно сказать, что синтез белков в клетках является самым главным, жизненно-важным процессом. Начало этого процесса происходит в ядре, развиваясь далее уже в цитоплазме. Синтез белка проходит следующую цепочку этапов:

  • процесс транскрипции — процесс переноса с ДК на РНК всей генетической информации;
  • процесс трансляции — представляет собой процесс преобразования триплетного нуклеотидного кода в определенную последовательность аминокислот.

За процесс нормального функционирования любых живых клеток помимо всего прочего отвечает процесс регуляции экспрессии генов.

Биосинтез белка в цитоплазме

Биосинтезом белка является довольно сложным процесс, при котором происходит синтез и полный цикл созревания белков, регулируемых значительным числом различных ферментов. Чаще всего он представляет собой синтезирование полипептидных цепей из определенных аминокислот, который происходит в рибосомах при участии определенных молекул мРНК и тРНК, отвечающих за трансляцию и в последующих, уже после того, как завершилась трансляция в модификациях цепей полипептидов. Процесс довольно энергозатратен и помимо этого в нем должны участвовать ионы-активаторы. Ключевыми моментами в биосинтезе белка являются:

  • выход в цитоплазму созревшей мРНК из ядра;
  • последующая за этим активация аминокислот;
  • далее образуется инициирующий комплекс при участии молекулы мРНК и соответствующей ей рибосомы, а затем происходит процесс инициации цепи из полипептидов;
  • следующим будет элонгация — построение последовательности полипептидов.
  • затем происходит процесс терминации, при которой происходит уже окончание синтеза первичной структуры цепи из полипептидов;
  • завершает все процессинг — при котором происходит образование белка.

Также Активацией аминокислот принято считать процесс присоединения карбоксильной группы аминокислоты к Зг-концу определенной тРНК. Аминокислота присоединяется к той же тРНК, у которой антикодон является комплементарым конкретному генетическому коду. В процессе происходит затрата энергии.

Аминоацилсинтетазы

Аминоацилсинтетазами называется группа ферментов, катализирующая данный процесс. Каждый фермент соответствует своей аминокислоте. Тот тип соединения, который образовывается в процессе катализации, называется соответственно наименованию искомой аминокислоты с прибавлением к названию -ил. К примеру, комплекс, который образовывается метионином и метиониновой тРНК называется метионил-тРНК.

Инициирующим комплексом называют систему, обеспечивающую начало в процессе белкового синтеза. Создание инициирующего комплекса у организмов-эукариот происходит в цитоплазме, а в некоторых случаях — на эндоплазматическом ретикулуме. Он соединяется в общей системе с мРНК, рибосомой и аминоацил-тРНК. У организмов-прокариот же этот процесс может происходить строго в цитоплазме.

Состав комплекса содержит стартовую аминоацил-тРНК, а также рибосомы и зрелую мРНК. Первая соединяется со стартовым кодоном мРНК. У всех видов организмов стартовый кодон единый и общий — AUG и соответствует метионину. Но при этом, метионин -тРНК — является стартовой аминоацил-тРНК только лишь у организмов-эукариот. У прокариот же стартовой аминоацил-тРНК является формилметионил-тРНК, которая образована нестандартной аминокислотой – формил-метионином.

Рибосомы — это части клеток, которые образованы двумя субъединицами (большая и малая). Эти клеточные компоненты отличаются отсутствием оболочек и в их состав входит рРНК и белок. У всех видов клеточных организмов рибосомы схожи по своему строению. Все они имеют по два участка, называемых P- и А-участками.

Процесс формирования инициирующего комплекса

Формирование инициирующего комплекса как биологические процесс будет удобнее и понятнее, если рассмотреть его на примере безъядерной клетки — прокариота. Данный процесс проходит следующие стадии:

  • начинается процесс присоединением формилмет-тРНК к P-участку малой субъединицы рибосомы;
  • затем происходит присоединение P-участка малой субъединицы рибосомы к инициирующей части мРНК, которая располагается на 5 х-конце и не ближе 25 нуклеотидов к началу молекулы;
  • завершается все заключительным этапом при котором присоединяется большая субъединица;
  • уже после того, как образовался инициирующий комплекс, происходит начало процесса синтеза полипептидной цепи — элонгации;
  • последующая аминоацил-тРНК будет определяться по принципу комплементарности между кодоном и антикодоном и будет присоединяться к А-участку рибосомы.

При воздействии пептидилтрансферазы на аминогруппу первой аминокислоты и карбоксильную группу второй происходит образование пептидной связи. Пептидилтрансфераза примечательна тем, что она фиксируется на рибосоме. Все время ее существования фермент находится на ней. Если соединение аминоацил-тРНК с процессом синтеза пептидной связи произошли правильно, то происходит процесс транслокации.

Транслокацией называют процесс, при котором происходит инициирующий комплекс смещается вдоль по направлению молекулы мРНК на расстояние трех нуклеотидов. Разные по составу белки всегда берут начало с разных по своему составу аминокислот. Но при этом изначальная аминоацил-тРНК всегда формилметионинова или метиониновая. Противоречие разрешается так — инициирующая аминоацил-тРНК (формилметиониновая) имеет отличие в том, что не образовывает пептидных связей со следующей по порядку аминокислотой. Иными словами, правила не работают при первом процессе транслокации рибосом. Процесс биосинтеза заканчивается стадией, называемой терминацией. Терминация происходит уже при условии, что на мРНК присутствуют стоп-кодоны: UAA, UAG, UGA. Когда полипептидная цепь созревает, эта стадия носит название процессинга. Процессинг представляет собой процесс образования третичной конформации молекулы. При процессинге возможны изъятия ряда аминокислотных последовательностей. У сложных белков при процессинге происходит процесс присоединения небелковых групп. Синтез белка является сложнейшим из процессов, происходящих в клетке. Более того, по сей день он еще не изучен до конца.В данной статье были рассмотрены общие механизмы и схема его работы, известная на данный момент науке.

Синтез белка

На долю белков приходится более половины сухой массы клетки, поэтому их синтез играет главную роль в поддержании клеточных структур и их функций, в росте и специализации клеток. Процесс биосинтеза белков у эукариот начинается в ядре, продолжается и заканчивается в цитоплазме. Он включает следующие этапы:

  • транскрипция — перенос генетической информации с Д Η К намРНК;
  • трансляция — преобразование триплетного нуклеотидного кода в аминокислотную последовательность.

Важным для нормального функционирования клетки также является вопрос регуляции экспрессии генов. Ответ на него позволит понять последовательность и механизм функционирования клетки как единого целого.

Биосинтез белка в цитоплазме

Определение 1

Биосинтез белка — сложный процесс синтеза и созревания белков, который регулируется большим количеством ферментов.

Как правило биосинтез белка заключается в синтезе полипептидных цепей из аминокислот, происходящем на рибосомах с участием молекул мРНК и тРНК (трансляция), и посттрансляционных модификациях полипептидных цепей. Он нуждается в энергии и участии ионов-активаторов. Мы рассмотрим лишь некоторые ключевые моменты. Процесс биосинтеза белка условно можно разделить на следующие этапы:

  • Выход зрелой мРНК из ядра в цитоплазму.
  • Активация аминокислот.
  • Образование инициирующего комплекса с участием мРНК и рибосомы и инициация полипептидной цепи.
  • Элонгация — построение полипептидной последовательности.
  • Терминация — окончание синтеза полипептидной цепи в виде первичной структуры.
  • Процессинг-образования вторичной и третичной структур белка.

Определение 2

Активация аминокислот — это присоединение карбоксильной группы аминокислоты к Зг-концу соответствующей тРНК. Аминокислота присоединяется к такой тРНК, антикодон которой комплементарен генетическому коду. Этот процесс проходит с использованием энергии.

Готовые работы на аналогичную тему

Аминоацилсинтетазы

Эту реакцию катализирует группа ферментов — аминоацилсинтетазы. Для каждой аминокислоты есть свой фермент. Соединение, которое образуется, называют по названию соответствующей аминокислоты с окончанием -ил (-ил). Например, комплекс между аминокислотой метионином и метиониновой тРНК называют метионил-тРНК, комплекс между лизином и лизиновой тРНК — лизил-тРНК и т.д.

Инициирующий комплекс — это система, которая обеспечивает начало синтеза белка. У эукариот он образуется в цитоплазме или на поверхности шероховатого эндоплазматического ретикулума, путем соединения в единую систему мРНК, рибосомы и аминоацил-тРНК. У прокариот образование инициирующего комплекса проходит только в цитоплазме.

Инициирующий комплекс состоит из стартовой аминоацил-тРНК, рибосомы и зрелой мРНК. Первая (стартовая) аминоацил-тРНК, с которой начинается образование пептидной цепи, присоединяется к стартовому колонну мРНК. Как у прокариот, так и у эукариот стартовый кодон одинаков — AUG. Такой кодон соответствует аминокислоте метионина. Но метионин -тРНК — стартовая аминоацил-тРНК только у эукариот. У прокариот стартовой аминоацил-тРНК является особая формилметионил-тРНК. Она образована нестандартной аминокислотой — формил-метионином (рис. 1).

Рисунок 1. Стартовые аминоацил-тРНК. Метионил-тРНК (слева) и формилметионил-тРНК (справа). Автор24 — интернет-биржа студенческих работ

Рибосомы — это клеточные структуры, образованные из двух субединиц (большой и малой). Они не имеют оболочек и состоят из рРНК и белка. Рибосомы прокариот и эукариот близкие по строению. Каждая из них имеет две специальные участки, которые называют P-участок и А-участок.

Формирование инициирующего комплекса

Рассмотрим формирование инициирующего комплекса на примере прокариотической клетки. Оно делится на ряд последовательных действий:

  1. Сначала формилмет-тРНК присоединяется к P-участку малой субъединицы рибосомы.
  2. Далее в P-участок малой субъединицы рибосомы присоединяется к инициирующей части мРНК, которая расположена на 5 х-конце, на расстоянии не менее 25 нуклеотидов от начала молекулы.
  3. Следующий, заключительный этап — присоединение большой субъединицы.
  4. После образования инициирующего комплекса начинается синтез полипептидной цепи, называется элонгации.
  5. Следующая аминоацил-тРНК определяется по принципу комплементарности между кодоном и антикодоном. Она присоединяется к А-участка рибосомы.

Под действием фермента пептидилтрансферазы между аминогруппой первой аминокислоты и карбоксильной группой второй аминокислоты образуется пептидная связь.

Важной особенностью пептидилтрансферазы является то, что этот фермент фиксирован на рибосоме. Он постоянно «прикреплен к месту работы». После правильного присоединения аминоацил-тРНК и образование пептидной связи между аминокислотами происходит транслокация.

Определение 3

Транслокация — это смещение инициирующего комплекса на три нуклеотида вдоль молекулы мРНК

Известно, что различные белки начинаются с разных аминокислот. Это вступает в противоречие с тем фактом, что начальной аминоацил-тРНК всегда формилметионинова или метиониновых. Решается эта проблема довольно просто — инициирующая аминоацил-тРНК (формилметионинова) не образует пептидной связи с последующей аминокислотой. То есть, первая транслокация рибосомы происходит не по правилам. Это, вроде бы, «холостой ход». Информация с мРНК считывается в направлении 5г — 3г, а полипептидная цепь растет в направлении N — С.

Окончание процесса биосинтеза называют терминации. Она происходит тогда, когда на МРН К встречается один из трех стоп-кодонов: UAA, UAG, UGA. Созревание полипептидной цепи называется процессингом. Он заключается в образовании третичной конформации молекулы. Во время процессинга возможные изъятия некоторых аминокислотных последовательностей. В сложных белках процессинг включает присоединение небелковых групп и тому подобное.

Процесс биосинтеза белка — один из самых сложных в клетке. Не все его нюансы на сегодня известны. Наиболее подробно исследован биосинтез белка прокариотических организма Е. coli. Но даже здесь есть еще некоторые невыясненные моменты. Мы рассмотрели биосинтез белка лишь схематично.

Синтез белка как биологический процесс и значение инициирующего комплекса

Особенности синтеза белка

Биосинтез белка в цитоплазме

Больше половины сухой массы клетки составляют белки. Соответственно, синтез белков имеет большое значение для обеспечения жизнедеятельности клеточных структур и их функций, а также для роста и специализации клеток.

У эукариот процесс биосинтеза белков начинается в ядре, а продолжается и завершается — в цитоплазме. Процесс биосинтеза состоит из 2 этапов:

  • транскрипции, под которой имеют в виду перенос генетической информации с ДНК на мРНК;
  • трансляции, за которой скрывается преобразование триплетного нуклеотидного кода в аминокислотную последовательность.

Чтобы клетка нормально функционировала, важна регуляция экспрессии генов. Благодаря ей можно легко разобраться в последовательности и механизме функционирования клетки как единого целого.

Что такое биосинтез белка?

Определение 1

Синтез белка — это непростой процесс синтеза и созревания белков, регуляция которого осуществляется при помощи большого количества ферментов.

Биосинтез белка основан на синтезе полипептидных связей из аминокислот, который происходит на рибосомах при участии молекул мРНК и тРНК (трансляция), а также на посттрансляционных модификациях полипептидных цепей. Этот процесс невозможен без участия ионов-активаторов и энергии.

Весь процесс биосинтеза белка условно включает следующие этапы:

  • процесс выхода зрелой мРНК из ядра в цитоплазму;
  • момент активации аминокислот;
  • формирование инициирующего комплекса при участии мРНК и рибосомы, инициация полипептидной цепи;
  • элонгацию или построение полипептидной последовательности;
  • терминацию или завершение синтеза полипептидной цепи в виде первичной структуры;
  • процессинг или образование вторичной и третичной белковых структур.
Определение 2

Под активацией аминокислот понимают присоединение карбоксильной группы аминокислоты к 3г-концу соответствующей тРНК.

Происходит присоединение аминокислоты к такой тРНК (ее антикодон комплементарен генетическому коду). Процесс основан на затратах энергии.

Аминоацилсинтетазы

Описанная выше реакция катализируется группой ферментов — они называются аминоацилсинтетазы. Каждая аминокислота имеет свой фермент. Образованное соединение получает название по названию соответствующей аминокислоты, к которому добавляется окончание —ил.

Пример 1

К примеру, комплекс между аминокислотой метионином и метиониновой тРНК — это метионил-тРНК. Комплекс между лизином и лизиновой тРНК — это лизил-тРНК и т. п.

Нужна помощь преподавателя?

Опиши задание — и наши эксперты тебе помогут!

Описать задание

Начало синтеза белка обеспечивается инициирующим комплексом. Этот комплекс у эукариотов формируется в цитоплазме либо на поверхности шероховатого эндоплазматического ретикулума. Происходит это в результате соединения в одну систему мРНК, рибосомы и аминоацил-тРНК.

Что касается прокариот, то у них этот комплекс формируется исключительно в цитоплазме.

В инициирующий комплекс входят стартовая аминоацил-тРНК, рибосома и зрелая мРНК. Образование пептидной цепи начинается с первой (стартовой) аминоацил-тРНК. Она присоединяется к стартовой колонне мРНК. Стартовый кодон у прокариот и эукариот не различаются — это AUG. Этот кодон соответствует аминокислоте метионина. При этом, стартовая аминоацил-тРНК, присущая только эукариотам — метионин-тРНК.

У прокариот стартовой аминоацил-тРНК выступает особая формилметионил-тРНК, которая образуется при помощи нестандартной аминокислоты, а именно — формил-метионином.

Рибосомы представляют собой клеточные структуры, которые образуются при помощи большой и малой субъединиц. У них отсутствуют оболочки. Рибосомы состоят из белка и рРНК. Наблюдается схожесть в строении рибосом прокариот и эукариот. У каждой из них есть два специальных участка: А-участок и Р-участок.

Процесс формирования инициирующего комплекса

На примере прокариотической клетки проще всего рассмотреть формирование инициирующего комплекса. Весь процесс — это определенные последовательные действия:

  • присоединение формилмет-тРНК к Р-участку малой субъединицы рибосомы;
  • П\присоединение Р-участка малой субъединицы рибосомы к инициирующей части мРНК. Она расположена на 5 х-конце. Расстояние от начала молекулы составляет минимум 25 нуклеотидов;
  • присоединение большой субъединицы. Это заключительный этап.

Окончательное формирование инициирующего комплекса дает начало синтезу полипептидной цепи — процессу элонгации.

Следующая аминоацил-тРНК определяется с помощью принципа комплементарности между кодоном и антикодоном. Происходит ее присоединение к А-участку рибосомы.

Пептидная связь между аминогруппой первой аминокислоты и карбоксильной группой второй аминокислоты формируется под влиянием фермента пептидилтрансферазы.

Замечание 1

Важно отметить, что у пептидилтрансферазы есть одна важная особенность — фиксация на рибосоме. Другими словами, этот фермент постоянно прикреплен к месту своей работы.

Далее идет процесс транслокации — он происходит в случае правильного присоединения аминоацил-тРНК и образования пептидной связи.

Определение 3

Под транслокацией понимают смещение инициирующего комплекса на 3 нуклеотида вдоль молекулы мРНК.

Различные белки берут начало из разных аминокислот. Такое утверждение выглядит спорным на фоне того, что начальная аминоацил-тРНК всегда формилметионинова или метионинова. Решение заключается в следующем: инициирующая аминоацил-тРНК (формилметионинова) не формирует пептидную связь с последующей аминокислотой. Это говорит о том, что первая транслокация рибосомы осуществляется не в соответствии с правилами. Условно его можно обозначить как «холостой ход».

Считывание информации с мРНК происходит в направлении 5г-3г, а рост полипептидной цепи — в направлении N-C.

Терминация — завершающий процесс биосинтеза. Она осуществляется при наблюдении на мРНК одного из трех стоп-кодонов: UAA, UAG, UGA.

Определение 4

Процессинг — это процесс созревания полипептидной цепи.

Суть его в том, что происходит образование третичной конформации молекулы. В ходе процессинга могут наблюдаться изъятия определенных аминокислотных последовательностей. Процессинг в сложных белках подразумевает присоединение небелковых групп и т. п.

Биосинтез белка — один из самых сложных процессов, происходящих в клетке. Далеко не все детали этого процесса известны и изучены учеными. Больше всего исследован биосинтез белка прокариотических организмов E coli, но тоже не полностью. Поэтому приведенная выше информация является схематичной.

Трансляция

Трансляция

Трансляция — это процесс, в результате которого рибосомы считывают генетическую информацию матричных РНК и создают белковый продукт в соответствии с этой информацией.
Специфические молекулы транспортрых РНК (тРНК) служат посредниками между кодом мРНК и конечной белковой последовательностью. В их состав входит последовательность, узнающая код мРНК и соответствующая этому коду аминокислота.
События трансляции разделяют на последующие события: инициацию, элонгацию и терминацию. На стадии инициации рибосома связывает мРНК и первая аминокислота присоединяется к рибосоме. Во время элонгации происходит рост полипептидной цепи. На стадии терминации рибосома отделяется от мРНК и процес трансляции заканчивается. У прокариот и эукариот процессы трансляции схожи, но имеются и существенные различия.
Трансляция происходит в цитоплазме, где находятся рибосомы. В зависимости от дальнейшего преднозначения синтезируемых белков, они могут образовываться либо в цитозоле, либо на поверхности шероховатого эндоплазматического ретикулума.

Полипептидные цепи синтезируются однонаправленно: с амино-конца к карбокси-концу.

При инициации первая и вторая молекулы аминоацил-тРНК спариваются с первыми двумя кодонами мРНК. Далее трансляция продолжается в направлении 5’–>3′ кодон за кодоном до тех пор, пока не достигнет стоп-сигнала, расположенного сразу же за кодоном, детерминирующим С-концевую аминокислоту.

Литература: 

К сожалению, список литературы отсутствует.

Литература: 

К сожалению, список литературы отсутствует.

Вместо комплементарного РНК-РНК узнавания, в которое вовлечена прединициирующая последовательность Шайна-Дальгарно прокариотических мРНК, эукариотические мРНК узнаются эукариотическими рибосомами по кэпированному 5′-концу с обязательным участием белка, например, eIF-4F инициаторного фактора ( Rhoads, 1988 ). Предполагается, что этот белок участвует в расплавлении вторичных структур 5′- областей мРНК, облегчая их связывание с малыми субчастицами рибосом. В отличие от прокариот, эукариотическая мРНК образует комплексы с белками ( мРНП , или мессенджер-рибонуклеопротеиды, или информосомы ), что обусловливает ее метаболическую стабильность. Вследствие этого у эукариот отсутствует постоянная интенсивная деградация и интенсивный ресинтез мРНК, которые, как правило, моноцистронны и имеют специфически модифицированный (кэпированный) 5′-конец. Все это обусловливает целый ряд особенностей инициации трансляции и ее регуляции у эукариотических организмов. Естественно, что метаболическая стабильность эукариотической мРНК делает регуляцию на уровне трансляции особенно важной в общей картине регуляции биосинтеза белка ( Спирин, 1986 ).

Литература: 

К сожалению, список литературы отсутствует.

Трансляция бактерии E.coli наиболее изучена

Синтез белка происходит на рибонуклеопротеиновом комплексе — рибосоме, в процессе трансляции mRNA. Рибосома состоит из большой и малой субъединиц, которые соединены в области инициации трансляции (translation initiation region -TIR) mRNA во время стадии инициации трансляции. Во время элонгации рибосома скользит вдоль mRNA и синтезирует полипептидную цепь. Элонгация продолжается до тех пор, пока рибосома не достигает стоп-кодона на mRNA — терминация трансляции. После терминации рибосома отделяется от синтезированного полипептида и способна снова повторить цикл трансляции mRNA.
Каждая стадия трансляции имеет свои регуляторные факторы, но у эукариот этих факторов гораздо больше, чем у прокариот.
Инициация

Инициация

Последовательность инициации трансляции у бактерии. 30S и 50S рибосомные субъединицы показаны светлым и темным серым цветом. [Laursen, et al. 2005]

Рибосомы прокариот инициируют трансляцию на мРНК уже во время транскрипции. Время необходимое для посадки рибосом порядка секунд, хотя это зависит от каждой мРНК. Рибосомы транслируют мРНК со скоростью приблизительно 12 аминокислот в секунду.
В инициации трансляции участвуют: рибосома, аминоацилированная и формилированная тРНК (fMet-tRNAfMet), мРНК и три белковых инициирующих фактора IF1, IF2 и IF3.
Бактериальная 70S рибосома состоит из большой 50S и малой 30S субъединицы. Имеется три tRNA связывающих сайта аминоацил — aminoacyl (A), пептидил — peptidyl (P), и сайт выхода — exit (E). Присоединение фактора IF3 к 30S рибосомной субъединице обеспечивает распад рибосомы на субъединицы. Фактор инициации IF1 связывается с A-сайтом 30S рибосомной субъединицы и служит инициатором присоединения tRNA к рибосомному P-сайту блокируя A-сайт. IF1 стимулирует активность IF3 и также распад рибосомных субъединиц.
После распада субъединиц, IF2, mRNA и fMet-tRNAfMet соединяются с 30S рибосомной субъединицей. Последовательность Шайно-Дальгарно (Shine-Dalgamo -SD) mRNA взаимодействует с anti-SD последовательностью 16S rRNA и инициирующий кодон присоединяется в Р-сайте рибосомы. Инициирующие факторы, особенно IF3, способствуют этому присоединению.
Инициаторная tRNA устанавливается в P-сайте 30S рибосомной субъединицы в три шага не зависимо от кодона, зависимо от кодона и fMet-tRNAfMet присоединение.
Все три шага обеспечиваются фактором IF2, который взаимодействует с fMet-tRNAfMet на рибосоме. IF3 стабилизирует присоединение fMet-tRNAfMet к рибосомному P-сайту и стабилизирует кодон-антикодон взаимодействие.

30S преинициаторный комплекс состояций из 30S рибосомной субъединицы, трех инициаторных факторов, mRNA в стартовой позиции, где fMet-tRNAfMet связана кодон независимо. Такой относительно нестабильный комплекс подвергается конформационному изменению, что обеспечивает кодон-антикодон взаимодействие и формирует более стабильный 30S инициаторный комплекс. Инициаторные факторы IF1 и IF3 отсоединяются, тогда как IF2 фактор стимулирует взаимодействие с 50S рибосомной субъединицей. После сборки рибосомы IF2 покидает комплекс. Во время этого процесса GTP связанный с IF2 гидролизуется до GDP и Pi. Вновь образованный 70S инициаторный комплекс, содержащий fMet-tRNAfMet как субстрат для пептидилтрансферазного центра 50S рибосомной субъединицы готов к вступлению в фазу элонгации трансляции.

Факторы инициации: IF-1, IF-2, IF-3 — белки временно связывающиеся с рибосомой, необходимые для инициации.

Этапы инициации трансляции

:

1. Факторы инициации IF-1 и IF-3 связываются с 30S-субчастицей, что обеспечивает ее взаимодействие с IF-2, инициаторной формилметиониновой-тРНК (Fmet-тРНКFMet) и GTP.

2. При связывании инициаторных белков IF-1 и IF-2 с 30S-субчастицей происходит диссоциация 70S-рибосомы на две субъединицы.

3. Комплекс 30S-субъединицы со всеми факторами инициации и Fmet-тРНКFMet связывается с 5′-концом мРНК вблизи кодона AUG и узнает. AUG-кодон мРНК.

Связывание 30S-субчастицы с мРНК находится под строгим контролем нуклеотидной последовательности, расположенной примерно
за 10 нуклеотидов до 5′-конца инициаторного кодона. Взаимодействию способствует комплементарное спаривание этой богатой пуринами по следовательности из 5-8н, называемой последовательностью Шайна-Дальгарно, с полипиримидиновым участком, находящимся вблизи 3′-конца 16S-pPHK.

4. Формирование полноценного функционального комплекса инициации завершается ассоциацией 50S-субчастицы с преинициаторным комплексом. При ассоциации 70S-рибосомы образуются два активных центра: Р- и А-участки. Fmet-TPHKFMet занимает Р-участок.

5. С образованием функциональной 70S-субчастицы отделяются все три белка инициации.

Элонгация

Факторы элонгации: EF-Tu и EF-Ts — белки связывающиеся с рибосомой, необходимые для элонгации трансляции.
В процессе инициации образуется 70S-рибосома связанная с мРНК, в Р-центре которой находится Fmet-тPHKFMet
Для образования первой пептидной связи необходимо, чтобы
аминоацил-тРНК, соответствующая следующему кодону, заняла А-центр.
Этапы элонгации трансляции:
1. EF-Tu-GTP связывает все аминоацил-тРНК, кроме Fmet-тPHKFMet, и доставляет их к А-центру комплекса 70S-рибосома-мРНКАминоацил-тРНК связывает EF-Tu и GTP. Образовавшийся комплекс (аминоацил-тРНК-[ЕF-Тu-GТР]) доставляет аминоацил-тРНК к А-участку. GTP гидролизуется, и комплекс (EF-Tu-GDP) отделяется от рибосомы. EF-Ts восстанавливает EF-Tu-GDP.

2. Когда оба участка, А и Р, заняты, пептидилтрансферазная активность 50S-субчастицы катализирует перенос группы Fmet с ее тРНК на аминогруппу аминоацил-тРНК, находящейся в А-участке. В результате в А-участке оказывается дипептидил-тРНК, а в Р – свободная тРНК.

3. тРНК освобождает Р-участок, образовавшаяся дипептидил-тРНК переместиться на него, а новый кодон должен быть готов к тому, чтобы занять освободившийся А-участок. Все эти процессы
осуществляются с помощью EF-G при GTP-зависимой транслокации рибосомы.

4. Теперь новый кодон, занявший А-сайт, готов к спариванию с родственной аминоацил-тРНК. Сразу после связывания аминоацил-тРНК с А-
участком высвобождается комплекс EF-Tu-GDP и происходит регенерация функционально активного EF-Tu-GTP. При этом EF-Tu-GDP взаи- модействует с белком EF-Ts, что приводит к отделению GDP и образованию комплекса EF-Tu•EF-Ts. Далее EF-Tu•EF-Ts взаимодействует с GTP, происходит регенерация EF-Tu-GTP и отделение EF-Ts, и оба соединения оказываются готовыми к следую- щему циклу.

Для прочтения следующего кодона и удлинения полипептидной цепи еще на одну аминокислоту вся серия реакций должна повториться.

При образовании каждой пептидной связи расходуется энергия, равная четырем энергетическим эквивалентам (если за один эквивалент принять энергию образования фосфатной связи): два эквивалента АТР потребляются при аминоацилировании тРНК и два эквивалента GTP-

в каждом цикле элонгации.

2. При инициации трансляции IF-2 узнает Fmet-тРНКFMet среди всех других аминоацил-тРНК, a EF-Tu отличает met-тРНКF Met от
Fmet-тРНКM Met при внедрении в А-участок.

3. Факторы элонгации EF-Tu и EF-G то присоединяются, то отделяются от рибосомы в зависимости от того, связаны ли они с GTP или с GDP соответственно.

4. Растущая полипептидная цепь всегда соединена своим карбоксильным концом с тРНК, которая соответствует С-концевой аминокислоте в растущей полипептидной цепи.

5. Пептидилтрансфераза катализирует формирование пептидных связей между карбоксильным концом растущей цепи и аминогруппой аминоацил-тРНК.

Терминация

Факторы терминации:
RF-1
вызывает отделение полипептидной цепи при считывании кодонов UAA и UAG;
RF-2
действует аналогичным образом при считывании UAA и UGA,
EF-3 может облегчить работу двух других факторов.
Этапы терминации трансляции:

1. В А-участке оказывается один из трех терминирующих кодонов – UAG, UAA или UGA. Из-за отсутствия тРНК, отвечающих этим кодонам,полипептидил-тРНК остается связанной с Р-участком.

2. RF-1 и RF-2 катализируют отсоединение полипептидной цепи от тРНК, отделение их обоих от рибосомы, а 70S-рибосомы – от мРНК.
RF-1 узнает в А-участке кодон UAA или UAG; RF-2 включается в том случае, когда в А-участке оказы-вается UAA или UGA;
RF-3 облегчает работу двух других факторов. Если терминирующим кодономявляется UAA, то эффективность процесса терминации оказывается наибольшей, поскольку этот кодон узнают оба фактора – RF-1 и RF-2. Однако, каким бы из стоп-кодонов ни обеспечивалась терминация,ее эффективность зависит от фланкирующих эти кодоны последовательностей в мРНК.

Когда расстояние от рибосомы до сайта инициации достигнет величины 100–200 нуклеотидов, в этом сайте может произойти новая инициация трансляции. Таким образом на одной мРНК
может находится несколько транслирующих рибосом — полирибосомы (рис)

Характерискика рибосом

Рибосомы
эукариот
: 80S, размер — 22×32 нм,
M ~4.5 млн.Да состоит из двух субъединиц.

Большая субъединица М=3.0млн.Да, 60S
[1rRNA 5S (~120н), 1рРНК 5.8S (~160н), 1rRNA 28S (4800н),
45-50 белковых молекул].
Малая субъединица
М=1.5 млн.Да, 40S [1rRNA18S (1900н), 30-35
белковые молекулы].

В цитоплазме эукариотической клетки содержится ~10 млн. рибосом
эукариотического типа.

Рибосомы прокариот:
70S, размер — 21×29 нм, М ~2.8 млн.Да,
состоит из двух субъединиц.

Большая субъединица М=1.8млн.Да 50S
[1rRNA 23S(~2904н), 1rRNA 5S(~120н), 34 белковые молекулы
(L1-L34)].

Малая субъединица М=1.0млн.Да 30S
[1rRNA 16S (~1542н), 21 белковые молекулы (S1-S21)].

В клетке E.coli содержится ~15тыс. рибосом, что составляет
– 1/4 сухой массы клетки. Рибосомы прокариотического типа
присутствуют в митохондриях и пластидах эукариот.

Малые и большие субъединицы могут диссоциировать на составляющие
РНК и белки и самособираются при определенных условиях.

Строение рибосом

Рибосома имеет два участка для связывания тРНК:

Р-центр (пептидил-тРНК-связывающий центр)
связывание тРНК присоединенной к растущей полипептидной
цепи.

А-центр (аминоацил-тРНК-связывающий участок)
связвает тРНК несущую следующую добавляемую аминокислоту,
располагается на большой субъединице рибосомы.

Аcn
центр

пептидилтрансфераза
образует пептидные связи между актами, прочно связывается
с рибосомой.

рибосома
р эукариот 22×32 нм, M~4.5 млн.Да 80S. Большая субъед М=3.0млн.Да, 60S [1rRNA 5S (~120н), 1рРНК 5.8S (~160н), 1rRNA 28S (~5 тыс.н), ~45 белков]; малая субъед М=1.5 млн.Да, 40S.
1rRNA18S (~2 тыс.н),~33 белка] | в цитоплазме Eu ~10 млн.р эукариотич типа |
р прокариот: 21×29 нм, М ~2.8 млн.Да, 70S | большая субъед М=1.8млн.Да 50S[1RNA 23S(~3200н), 1rRNA 5S(~120н), 34белка]; малая субъед М=1.0млн.Да 30S[1rRNA 16S (~1600н), 21 белок] | E.coli ~15тыс р – 1.4 сухой m кл | р прокариотич типа присут в митох и пластидах Eu |
| P-центр пептидил-тРНК-связывающий центр, А-центр большой субъед. р – аминоацил-тРНК-связывающий участок, Аcn центр | пептидилтрансфераза – образ. пептидные связи м-у актами, прочно связан с р | р прокариот мельче и сод меньше компонентов
мРНК [кэп | 5’-НТО | AUG | транслируемая область | стоп 3’-НТО | поли(А)]
инициация сканирование РНК малой субъединицой рибосомы | связывание со стартовым (инициирующим) кодоном AUG-5’ конца – сборка рибосомы | инициаторный комплекс, факторы инициации | Первой к мРНК присоед малая субъед. р связанная с инициаторной-тРНК узнающей AUG и несущей метионин. Процесс катализируется фактором инициации 2 IF2 – фосфорилирование одной из трех его субъед. снижает активность ф-та – контроль белкогого синтеза (незрелые эритроциты) | элонгация 5’?3’ | транслокация – возвращение пустой тРНК в цитоплазму | транслокация рибосомы вдоль мРНК сопровожд. конформационными изменениями с затратой энергии GTP (4GTP вцелом на 1 пепт. связь) | кодон мРНК спаривается с антикодоном тРНК | карбоксильный конец растущего полипептида связан ковалентно с тРНК – пептидил-тРНК | образ. полисомы | терминирующий кодон (стоп-кодон) UAA, UAG, UGA – диссоциация рибосомы – терминация | фактор освобождения-белок связ с стоп-кодоном и меняет активность пептидилтрансферазы кот присоед к пептидил-тРНК Н2О и полипептид отделяется от тРНК и выходит из р | Цикл элонгации составляет 1/20 сек – белок в 300 акт синтезируется за 20 сек Ecoli

Литература: 

К сожалению, список литературы отсутствует.

70-90Н | вторичная стр-ра- клеверный лист | CCA 3′ const для всех tRNA |к концевому аденозину присоед акта |
наличие тимина, псевдоуридина-пси, дигироуридина ДГУ в D-петле — защита от рибонуклеаз ? долгоживущие | Разнообразие первичных структур tРНК — 61+1 — по кол-ву кодонов + формилметиониновая tРНК, у кот антикодон такой же, как у метиониновой tРНК. Разнообразие третичных структур — 20 (по кол-ву аминокислот) | рекогниция — образование ковалентной связи м-у tРНК и актой | аминоацил-тРНК-синтетазы присоединяют акты к тРНК

Функция тРНК заключается в переносе аминокислот из цитоплазмы в рибосомы, в которых происходит синтез белков.
тРНК связывающие одну аминокислоту называются изоакцепторными.
Всего в клетке одновременно существует 64 различных тРНК.
Каждая тРНК спаривается только со своим кодоном.
Каждая тРНК распознает свой собственный кодон без участия аминокислоты. Связавшиеся с тРНК аминокислоты химически модифицировали, после чего анализировали получившийся полипептид, который содержал модифицированную аминокислоту. Цистеинил-тРНКCys (R=Ch3-SH) восстанавливали до аланил-тРНКCys (R=Ch4).
Большинство тРНК, не зависимо от их нуклеотидной последовательности, имеют вторичную структуру в форме клеверного листа из-за наличия в ней трех шпилек.

Особенности структуры тРНК

На 3′-конце молекулы всегда находятся четыре неспаренных нуклеотида, причем три из них – это обязательно ССА. 5′- и 3′-концы цепи РНК образуют акцепторный стебель. Цепи удерживают-ся вместе благодаря комплементарному спарива-нию семи нуклеотидов 5′-конца с семью нуклеотида-ми, находящимися вблизи 3′-конца. 2. У всех моле-кул имеется шпилька T?C, обозначаемая так пото-му, что она содержит два необычных остатка: рибо-тимидин (Т) и псевдоуридин (?). Шпилька состоит из двухцепочечного стебля из пяти спаренных осно- ваний, включая пару G-C, и петли длиной семь нуклеотидов. Тринуклеотид Т?С всегда расположен
в одном и том же месте петли. 3. В антикодоновой шпильке стебель всегда представлен семью спарен-
ными основаниями. Триплет, комплементарный родственному кодону,– антикодон – находится в пет-
ле, состоящей из семи нуклеотидов. С 5′-конца антикодон фланкируют инвариантный остаток ура-
цила и модифицированный цитозин, а к его 3′-концу примыкает модифицированный пурин, как правило
аденин. 4. Еще одна шпилька состоит из стебля длиной три-четыре пары нуклеотидов и петли варь-
ирующего размера, часто содержащей урацил в вос-становленной форме – дигидроурацил (DU). Наиболее сильно варьируют нуклеотидные по-следовательности стеблей, число нуклеотидов меж-ду антикодоновым стеблем и стеблем Т?С (вариа-бельная петля), а также размер петли и локализация остатков дигидроурацила в DU-петле.
[Сингер, 1998].

Третичная структура тРНК

L-образная структура.

Присоединение аминокислот к тРНК

Для того чтобы аминокислота могла образовывать полипептидную цепь она должна присоединиться к тРНК с помощью фермента аминоацил-тРНК-синтетазы. Этот фермент образует ковалентную связь между карбоксильной группой аминокислоты и гидроксильной группой рибозы на 3’-конце тРНК при участии АТФ. Аминоацил-тРНК-синтетаза узнает специфический кодон не из-за наличия антикодона на тРНК, а по наличию специфического сайта узнавания на тРНК.
Всего в клетке имеется 21 различных аминоацил-тРНК-синтетаз.
Присоединение происходит в две стадии:
1. Карбоксильная группа аминокислоты присоединяется к а-фосфату АТФ. Полученный нестабильный аминоацил-аденилат стабилизируется связываясь с ферментом.
2. Перенос аминоацильной группы аминоацил-аденилата на 2’ или 3’-OH-группу концевой рибозы тРНК
Некоторые аминоацил-тРНК-синтетазы состоят из одной полипептидной цепи, другие – из двух или четырех идентичных цепей, каждая молекулярной массой от 35 до 115 кДа. Некоторые димерные и тетрамерные ферменты состоят из субъединиц двух типов. Четкой корреляции между размером молекулы фермента или характером его субъединичной структуры и специфичностью не существует.
Специфичность фермента определяется его прочным связыванием с акцепторным концом тРНК, DU-участком и вариабельной петлей. Некоторые ферменты, по-видимому, не распознают антикодоновый триплет и катализируют реакцию аминоацетилирования даже при измененном антикодоне. Однако отдельные ферменты проявляют пониженную активность по отношению к таким модифицированным тРНК и при замене антикодона присоединяют не ту аминокислоту.

70-90н | вторичная стр-ра- клеверный лист | CCA 3′ const для всех tRNA |к концевому аденозину присоед акта |
наличие тимина, псевдоуридина-пси, дигироуридина ДГУ в D-петле — защита от рибонуклеаз ? долгоживущие | Разнообразие первичных структур tРНК — 61+1 — по кол-ву кодонов + формилметиониновая tРНК, у кот антикодон такой же, как у метиониновой tРНК. Разнообразие третичных структур — 20 (по кол-ву аминокислот)

Имеются два вида тРНК связывающие метионин тРНКFMet и тРНКMMet у прокариот и, тРНКIMetи тРНКMMet — у эукариот. К каждой тРНК добавляется метионин с помощью соответствующих аминоацил-тРНК-синтетез. метионин присоединенный к тРНКFMet и тРНКIMet формилируется ферментом метионил-тРНК-трансформилазой до Fmet-тРНКFMet. тРНК нагруженные формилметионином узнают инициаторный кодон AUG.

Литература: 

К сожалению, список литературы отсутствует.

Роль инозина, L-аргинина и L-карнитина в кардиометаболической терапии

Авторы: Л. А. Мищенко

Статья в формате PDF

В настоящее время не вызывает сомнений постулат, что сокращающееся сердце остро нуждается в биологическом топливе – аденозинтрифосфате (АТФ). Метаболическая коррекция при сердечно-сосудистых заболеваниях является аргументированным подходом с точки зрения патофизиологии [1]. Под метаболической терапией (МТ) в кардиологии понимают улучшение энергетического метаболизма в сердечной мышце путем фармакологического управления процессами образования и переноса энергии на уровне кардиомиоцитов без влияния на коронарный кровоток и системную гемодинамику. Принципиально можно выделить два основных направления МТ – оптимизацию процессов образования и расхода энергии, а также нормализацию баланса между интенсивностью свободнорадикального окисления и антиоксидантной защитой [2].

Ведущие клиницисты и эксперты-фармакологи уделяют особое внимание различным способам увеличения концент­рации АТФ в кардиомиоцитах, в том числе посредством потребления пищевых продуктов или биологических добавок, богатых микронутриентами, необходимыми для эффективного сокращения и расслабления миокарда.

К сожалению, оценка влияния микронутриентов на метаболизм миокарда проводилась достаточно редко и ограничивалась одним компонентом. Однако на протяжении ряда последних лет отмечается значительный прогресс в изучении эффективности МТ, появились новые данные доказательной медицины, подтверждающие целесообразность использования метаболиков.

Основным источником АТФ в сердечной мышце являются жирные кислоты и углеводы. Однако превращение этих макронутриентов в биологическую энергию (АТФ) возможно только при наличии таких микронутриентов, как коэнзим Q10, тиамин, рибофлавин, L-карнитин, таурин, L-аргинин и другие аминокислоты, функционирующих в виде основных кофакторов синтеза и транспорта АТФ, а также веществ, поддерживающих физиологические функции сердца (инозин) [3].

Данные доказательной медицины убедительно свидетельствуют, что метаболическую терапию при кардиоваскулярных заболеваниях следует направлять на восстановление запасов L-карнитина, L-аргинина, инозина.

Инозин (рибоксин) широко применяется в МТ, обладает антигипоксическими и антиаритмическими свойствами. Предшественник АТФ инозин принимает участие в обмене глюкозы и способствует активации метаболизма в условиях гипоксии и отсутствия или недостатка АТФ. Считается, что инозин активирует метаболизм пировиноградной кислоты, необходимой для обеспечения нормального процесса тканевого дыхания, и способствует активации ксантиндегидрогеназы. Рибоксин стимулирует сократительную активность миокарда, способствует его расслаблению во время диастолы, улучшает регенерацию тканей сердца и коронарное крово­обращение.

Инозин, благодаря своим противовоспалительным, анаболическим, метаболическим, антигипоксическим и антиаритмическим свойствам, принимает участие в регуляции многих физиологических процессов в организме. В настоящее время известно, что инозин обладает положительным инотропным эффектом, улучшает сократительную функцию сердца за счет силы сердечных сокращений и минутного объема кровообращения [4], а также отрицательным хронотропным эффектом [5]. При этом он имеет свойства органопротектора (в том числе кардиопротектора), ограничивая стрессовые и гипоксические повреждения [6]. Органопротекторный эффект инозина в критических ситуациях частично связывают с его способностью увеличивать в эритроцитах продукцию 2,3-дифосфоглицерата, способствующего увеличению диссоциации оксигемоглобина и отдачи кислорода тканям.

Учитывая универсальность анаболического действия инозина, а также тот факт, что после введения в организм он преимущественно накапливается в миокарде, почках, печени и скелетных мышечных волокнах, являясь источником энергии и обеспечивая органопротекцию, можно предположить, что он незаслуженно забыт.

L-карнитин представляет собой аминокислоту, которая синтезируется в организме и принимает активное участие в метаболизме и функционировании митохондрий. В организме человека содержится 15-20 г карнитина, большая часть которого (>95%) локализована в скелетной мускулатуре; эта аминокислота поступает в организм с пищей, преимущественно из мясных и молочных продуктов. Во время голодания и после употребления большого количества жирной пищи доля карнитина, подвергающаяся ацилированию в печени и ­почках, значительно увеличивается, и наоборот, ­употребление ­большого количества углеводов вызывает быстрое снижение уровня ацетил-L-карнитина в печени. L-карнитин считается условно незаменимым микронутриентом; в последние годы в зарубежной литературе активно ­используется термин ­«функциональный дефицит карнитина», который применяется для описания аномальных клинических проявлений, корригируемых приемом этой аминокислоты.

В 2013 г. был опубликован систематический обзор 13 контролируемых исследований, включавших в общей сложности 3629 пациентов, который показал, что применение L-карнитина приводит к достоверному снижению смертности от любых причин и с высокой степенью достоверности – к уменьшению частоты возникновения желудочковых аритмий (ЖА) и развития стенокардии. Потенциальный механизм, лежащий в основе положительного действия L-карнитина при сердечно-сосудистой патологии, является многофакторным и может частично быть связан со способностью данного вещества улучшать энергетический метаболизм в митохондриях кардиомиоцитов за счет усиления транспорта длинноцепочечных жирных кислот из цитозоля в митохондриальный матрикс, где происходит β-окисление. Более того, L-карнитин оказывает благоприятное действие на ремоделирование левого желудочка, приводя к значительному снижению его объема после острого инфарк­та миокарда [7].

L-карнитин широко используется для лечения разнообразной кардиологической патологии. Он снижает частоту ЖА после острого инфаркта миокарда (ОИМ), что может частично объяснять отмеченное в исследовании Carnitine Ecocardiografia Digitalizzata Infarto Miocardico 2 (CED-IM 2) снижение смертности на 39% в первые 5 дней при применении данного препарата (27 против 44 случаев, относительный риск – ОР – 0,61; 95% доверительный интервал – ДИ – 0,37-0,98, р=0,041) [8]. В недавно опубликованном метаанализе 17 рандомизированных клинических исследований (n=1625), в которых приняли участие пациенты с сердечной недостаточностью (СН), показано, что включение L-карнитина в схему терапии способствует повышению общей эффективности лечения (отношение шансов – ОШ – 3,47; р<0,01), увеличению фракции выброса левого желудочка (взвешенная разность средних – ВРС – 4,14%; р<0,01), ударного объема (ВРС 8,21 мл; р=0,01), сердечного выброса (ВРС 0,88 л/мин; р<0,01), отношения скорости заполнения желудочков в ранней и поздней фазах (ВРС 0,23; р<0,01).

Авторы метаанализа (Song X. et al., 2017) подчеркнули, что введение L-карнитина ассоциировалось со статистически значимым снижением сывороточной концентрации мозгового натрийуретического пептида (ВРС -124,60 пг/мл; р=0,01), N-терминального фрагмента мозгового натрийуретического пептида (ВРС -510,36 пг/мл; р<0,01), а также уменьшением конечно-систолического диа­метра левого желудочка (ВРС -4,06 мм; р<0,01), конечно-диа­столического размера левого желудочка (ВРС -4,79; р<0,01), конечно-систолического объема левого желудочка (ВРС -20,16 мл; 95% ДИ от -35,65 до -4,67; р<0,01).

Эти данные указывают на то, что L-карнитин может снижать смертность от любых причин, а также частоту возникновения ЖА и развития стенокардии у пациентов с ОИМ. В ряде исследований выявлено, что L-карнитин способствует снижению уровня триглециридов, общего холестерина, холестерина липопротеинов низкой плотности [9]. L-карнитин эффективно нивелирует клинические проявления СН, улучшает функцию сердца и имеет хорошую переносимость.

L-аргинин – условно незаменимая аминокислота. L-аргинин необходим для синтеза белков и некоторых биологически важных молекул, таких как орнитин, пролин, креатин, агмантин. Эта аминокислота является субстратом для фермента, отвечающего за синтез оксида азота. Последний образуется в эндотелиоцитах и отвечает за релаксацию гладкой мускулатуры и снижение артериального давления. «Любое улучшение эндотелиальной функции будет способствовать предотвращению кардиоваскулярной патологии», – считают М. McRae и соавт. Установлено, что L-аргинин уменьшает адгезию лейкоцитов к эндотелию, снижает агрегацию тромбоцитов, уровень эндотелина в крови, увеличивает эластичность стенок артерий.

Недавно опубликованный обзор результатов 7 метаанализов убедительно продемонстрировал преимущества назначения ­L-аргинина больным артериальной гипертензией: прием данной аминокислоты способствовал уменьшению систолического и диастолического артериального давления на 2,2-5,4 и 2,7-3,1 мм рт. ст. соответственно [14]. Кроме того, использование L-аргинина у беременных с гестационной гипертензией также сопровождалось снижением уровня диастолического артериального давления на 4,9 мм рт. ст. Авторы обзора особо отметили, что применение L-аргинина позволило сократить длительность стационарного лечения пациентов, перенесших оперативное вмешательство.

В ряде рандомизированных исследований у пациентов с ишемической болезнью сердца были выявлены положительные эффекты L-аргинина: увеличение переносимости физической нагрузки и снижение агрегации тромбоцитов [10], снижение функционального класса стенокардии, нормализация артериального давления, улучшение качества жизни [11]. Результаты многочисленных исследований последних лет свидетельствуют о возможности эффективного и безопасного применения свойств L-аргинина как активного донатора NO в клинической практике при сердечно-сосудистых заболеваниях.

Чрезвычайно важно, чтобы пациентам с середечно-сосудистыми заболеваниями прежде всего были обязательно назначены жизнеспасающие средства – препараты базисной терапии. Но также не следует забывать о МТ, которая, с одной стороны, поможет оптимизировать энергообмен миокарда, повышая его жизнеспособность, а с другой – обеспечит антиоксидантный эффект, что крайне важно для нормального метаболизма [13].

! На отечественном рынке появился долгожданный комплекс нутриентов Таникор (ACINO, Швейцария), одна капсула которого содержит сбалансированный состав необходимых компонентов для полноценного функционирования сердечно-сосудистой системы: 300 мг ­L-аргинина, 100 мг L-карнитина и 50 мг инозина [12].

Таникор может быть рекомендован в качестве диетической добавки к рациону питания, как дополнительный источник инозина, L-аргинина и L-карнитина, способствует нормализации функционального состояния обмена веществ при общей терапии сердечно-сосудистых заболеваний в анамнезе, гиперхолестеринемии и эндокринологических нарушений. Нутрицевтик может применяться в комплексе мер для стимуляции энергообеспечения в клетках и содействия нормализации обмена веществ при различных патологических состояниях, для снижения концентрации свободных радикалов, обеспечения сохранности органелл и клеточных мембран [12].

Литература

1.    Резван В.В., Васильева И.С. Роль метаболической терапии в со­временной кардиологии // РМЖ. 2016. №19. С. 1276-1280.
2.    Житникова Л. М. Метаболическая терапия, или кардиоцитопротекция как необходимый компонент комбинированной терапии сердечно–сосудистых заболеваний.//РМЖ. Кардиология. 2014. № 4. С. 137-143.
3.    Ueland T., Svardal A., Øie E., Askevold E.T., Nymoen S.H., Bjørndal B., Dahl C.P., Gullestad L., Berge R.K., Aukrust P. Disturbed carnitine regulation in chronic heart failure – increased plasma levels of palmitoyl-carnitine are associated with poor prognosis. Int J Cardiol 2013; 167: 1892-9.
4.    Czarnecki W., Noble M. I.M. Mechanism of the inotropic action of inosine on canine myocardium.//Cardiovascular Research. – 1983. – Vol. 17, 
Issue 12. – P. 735-739.
5.    Hoffmeister H.M., Betz R., Fiechtner H., Seipel L. Myocardial and circulatory effects of inosine. //Cardiovascular Research. – 1987. – Vol. 21, № 1. – P. 65-71.
6.    Szabo C., Stumpf N., Radovits T. et al. Effects of inosine on reperfusion injury after heart transplantation // European Journal of Cardio-Thoracic Surgery. – 2006. – Vol. 30. – P. 96-102.
7.    Dinicolantonio J.J., Lavie C. J., Fares H. et al. L-Carnitine in the Secondary Prevention of Cardiovascular Disease: Systematic Review and Meta-analysis. Mayo Foundation for Medical Education and Research Mayo Clin Proc. 2013.
8.    Rizzon P., Biasco G., Di Biase M. et al. High doses of L-carnitine in acute myocardial infarction: metabolic and antiarrhythmic effects.//Eur Heart J. 1989; 10(6): 502-508.
9.    Губергриц Н.Б. и соавт. L-карнитин: от биохимических свойств к клиническому применению.// Сучасна гастроентерологія. – 2012. – № 2 (64).
10. Созыкин А.В., Ноева Е. А., Балахонова Т. В. и др. (2000). Влияние L-аргинина на агрегацию тромбоцитов, функцию эндотелия и толерантность к физической нагрузке у пациентов со стабильной стенокардией напряжения. Тер. архив, 72(8): 24-27.
11. Palloshi A., Fragasso G., Piatti P. et al. (2004). Effect of oral L-arginine on blood pressure and symptoms and endothelial function in patients with systemic hypertension, positive exercise tests, and normal coronary arteries. Am. J. Cardiol., 93(7): 933-95.
12. Инструкция к использованию Таникор.
13. Егорова М.С., Гармаш Ю. Ю. Современные цитопротекторы (антигипоксанты, антиоксиданты): в чем феномен популярности в кардиологии и неврологии? УМЧ. 1 (117) – I/II 2017.
14. McRae M. P. Therapeutic Benefits of l-Arginine: An Umbrella Review of Meta-analyses. J Chiropr Med. 2016 Sep; 15(3): 184-189.

UA-TANI-PUB‑042018-001

Медична газета «Здоров’я України 21 сторіччя» № 11-12 (432-433), червень 2018 р.

СТАТТІ ЗА ТЕМОЮ Кардіологія

01.11.2021 Кардіологія Антикоагулянти: для чого потрібні, рекомендації

Антикоагулянти – це група лікарських засобів, що перешкоджають утворенню тромбів. Впливаючи на фактори згортання, вони забезпечують плинність і знижують в’язкість крові. Незважаючи на ймовірність неконтрольованої кровотечі, в медицині антикоагулянти застосовують для профілактичних і терапевтичних цілей….

26.10.2021 Кардіологія Погляд на інтенсивність антитромбоцитарної терапії: сучасні тенденції

На сьогодні питання антитромбоцитарної терапії (АТТ) у пацієнтів із серцево-судинними захворюваннями (ССЗ) залишаються вельми актуальними. Основним аспектам АТТ, зокрема ініціації, інтенсивності та тривалості, було присвячено вебінар, що відбувся 2 вересня 2021 р. за підтримки компанії «Санофі»….

17.10.2021 Ревматологія Біль у колінному суглобі: що треба знати сімейному лікарю?

Больові відчуття в коліні спричиняються значною кількістю чинників, починаючи від травматичного ушкодження й закінчуючи дегенеративними змінами. Для ефективного лікування пацієнта лікар має чітко визначити етіологічний чинник артриту та врахувати особливості перебігу хвороби. Цю тему в рамках конференції Pro Family 2021 (11-12 вересня) висвітлила керівник навчального центру Інституту ревматології (м. Київ), доктор медичних наук, професор Єлизавета Давидівна Єгудіна….

17.10.2021 Кардіологія Молодий пацієнт із високим кардіометаболічним ризиком: що робити?

Під час чергової науково-практичної конференції «Консиліум фахівців при коморбідних станах», яка відбулася 11 вересня, особливе зацікавлення слухачів викликав тематичний блок «Від менархе до клімаксу, або Як важко бути жінкою». Завершувала цей блок доповідь завідувачки кафедри кардіології Національного університету охорони здоров’я України ім. П. Л. Шупика (м. Київ), доктора медичних наук, професора Марини Миколаївни Долженко на основі клінічного випадку….

Start Codon — обзор

Хотя бомбардировка частицами может указывать на специфичность трихома, количество пораженных трихомов может быть не очень большим, а процедура разрушительна. В качестве альтернативы, для более глубокого исследования можно получить стабильные трансгенные растения, экспрессирующие конструкцию промотор-репортер. В этом разделе конструкция с промотором SlTPS9 , управляющим слиянием GUS sYFP1 , была введена в S . lycopersicum cv.Moneymaker для проверки промоторной активности SlTPS9 в стабильно трансформированных растениях.

2.2.2 Стабильная трансформация томата

Семена томата ( S . lycopersicum сорт Moneymaker) стерилизовали поверхность в 70% этаноле в течение 2 минут, а затем 20 минут в 25% гипохлорите. После пятикратного ополаскивания в стерильной воде их поместили на среду для проращивания, которая состоит из 2,5 г L -1 среды Murashige и Skoog, включая витамины Gamborg B5 (MS + Vit B5), 10 г L -1 сахарозы и 0.5 г L — 1 MES, pH 5,8 (Cortina & Culianez-Macia, 2004). Проростки выращивали при 25 ° C и относительной влажности 70% в течение 10 дней (90 мкмоль м — 2 с — 1 ; 8 ч темнота, 16 ч света). Семядоли стерильных проростков томатов были отрезаны, кончики удалены и разрезаны поперечно скальпелем на два фрагмента. Срезы семядолей помещали адаксиальной стороной вниз в чашки Петри размером 90 × 15 мм, содержащие среду для культивирования (COM), и инкубировали в течение 1 дня. Среда COM состояла из 4 файлов.5 г L -1 MS + Vit B5, 30 г L -1 сахароза, 0,5 г L -1 MES, 2 мг L -1 зеатин, 0,1 мг L -1 индол-3- уксусная кислота (ИУК), 0,05 мг L — 1 2,4-дихлорфеноксиуксусная кислота (2,4-D) и 200 мкг M ацетосирингона, pH 5,8. А . tumefaciens штамм GV3101 (pMP90), несущий конструкцию, которая также содержит селективный ген неомицинфосфотрансферазы ( NPTII ), выращивали в течение ночи до OD600 0.6–0,8 в модифицированной среде Лурия Бертани (1% бакто-триптон, 0,5% дрожжевой экстракт и 0,25% NaCl, pH 7,0). Перед сокультивированием культуру центрифугировали (15 мин при 3000 rcf) и осадок ресуспендировали в жидкой среде, состоящей из 4,5 г L -1 MS + Vit B5, 30 г L -1 сахарозы и 0,5 г L — 1 MES, pH 5,8. Эксплантаты семядолей томатов удаляли из чашек с COM и переносили в бактериальную суспензию на 5 мин. Затем они были помещены на свежие чашки COM после короткой сушки на стерильной фильтровальной бумаге.После 2 дней культивирования на COM эксплантаты помещали в среду для посткультивирования, состоящую из 4,5 г L -1 MS + Vit B5, 30 г L -1 сахарозы, 0,5 г L -1 MES, 2 мг L -1 зеатин, 0,1 мг L -1 IAA, 200 мг L -1 цефотаксим и 50 мг L -1 ванкомицин, pH 5,8. Еще через 3 дня эксплантаты переносили в среду, индуцирующую ростки (SIM), состоящую из 4,5 г L -1 MS + Vit B5, 10 г L -1 глюкозы, 0.5 г L -1 MES, 2 мг L -1 зеатина, 0,1 мг L -1 IAA, 100 мг L -1 канамицина и 500 мг L -1 карбеницилина, pH 5,8. Планшеты инкубировали при 25 ° C, относительной влажности 70% под флуоресцентным светом (90 мкмоль м -2 с -1 ; 8 часов в темноте, 16 часов на свету). Эксплантаты переносили на новую SIM-карту каждые 2 недели. Каллусы удаляли из эксплантатов, когда они вырастали более 0,5 см в ширину, и переносили на свежую SIM-карту. Отростки этих каллусов собирали и помещали в стерильные контейнеры для растений (68 × 66 мм), содержащие среду, индуцирующую корнеобразование (RIM).RIM состоял из 4,5 г L -1 MS + Vit B5, 10 г L -1 сахарозы, 0,5 г L -1 MES, 0,25 мг L -1 индол-3-масляной кислоты (IBA), и 200 мг цефотаксима L — 1 , pH 5,8. После образования корней растения осторожно извлекали из контейнеров и помещали в почву.

Почему AUG является стартовым кодоном ?: Теоретические минимальные кольца РНК: максимизация искажений кодированной информации 1-й кодон для универсального инициирующего кодона AUG

.2020 июн; 42 (6): e11. DOI: 10.1002 / bies.2011. Epub 2020 29 марта.

Принадлежности Расширять

Принадлежности

  • 1 Лаборатория AGEIS EA 7407, Инструменты группы для e-Gnosis Medical & Labcom CNRS / UGA / OrangeLabs Telecom4Health, Медицинский факультет, Университет Гренобль-Альпы, Ла Тронш, F-38700, Франция.
  • 2 Национальные коллекции естествознания, Еврейский университет Иерусалима, Иерусалим, 91404, Израиль.

Элемент в буфере обмена

Жак Демонжо и др. Биологические исследования. 2020 июн.

Показать детали Показать варианты

Показать варианты

Формат АннотацияPubMedPMID

. 2020 июн; 42 (6): e11. DOI: 10.1002 / bies.2011. Epub 2020 29 марта.

Принадлежности

  • 1 Лаборатория AGEIS EA 7407, Инструменты группы для e-Gnosis Medical & Labcom CNRS / UGA / OrangeLabs Telecom4Health, Медицинский факультет, Университет Гренобль-Альпы, Ла Тронш, F-38700, Франция.
  • 2 Национальные коллекции естествознания, Еврейский университет Иерусалима, Иерусалим, 91404, Израиль.

Элемент в буфере обмена

Полнотекстовые ссылки Опции CiteDisplay

Показать варианты

Формат АннотацияPubMedPMID

Абстрактный

Рациональный дизайн теоретических минимальных колец РНК предопределяет AUG как универсальный стартовый кодон.Этот дизайн максимизирует разнообразие кодируемых аминокислот по минимальной длине последовательности, определяя in silico теоретические минимальные кольца РНК, предковые гены-кандидаты. Кольца РНК кодируют 21 аминокислоту и стоп-кодон после трех последовательных раундов трансляции и образуют шпильку «шпилька-петля», задерживающая деградацию. Двадцать пять колец РНК соответствуют этим ограничениям, десять начинаются с универсального инициирующего кодона AUG. Среди оставшихся колец РНК не существует смещения первого кодона. Конструкция кольца РНК предопределяет AUG как инициирующий кодон.Это единственное объяснение того, что AUG является стартовым кодоном. Конструкция кольца РНК определяет дополнительные свойства, подобные гену и тРНК кольца РНК, описанные ранее, поскольку он предположительно имитирует ограничения на первичные РНК жизни.

Ключевые слова: истоки жизни; рибосомальная РНК; симуляция; телеономия; перевод.

© 2020 WILEY Periodicals, Inc.

Похожие статьи

  • Смещение для направленной асимметрии 3′-доминантного кодона в теоретических минимальных кольцах РНК.

    Demongeot J, Селигманн Х. Demongeot J, et al. J Comput Biol. 2019 сентябрь; 26 (9): 1003-1012. DOI: 10.1089 / cmb.2018.0256. Epub 2019 22 мая. J Comput Biol. 2019. PMID: 31120344

  • Теория происхождения жизни Уроборос: 22-нуклеотидные теоретические минимальные кольца РНК отражают эволюцию генетического кода и механизмов трансляции тРНК-рРНК.

    Demongeot J, Селигманн Х. Demongeot J, et al. Acta Biotheor. 2019 декабрь; 67 (4): 273-297. DOI: 10.1007 / s10441-019-09356-w. Epub 2019 6 августа. Acta Biotheor. 2019. PMID: 31388859

  • Теоретические минимальные кольца РНК имитируют молекулярную эволюцию до опосредованной тРНК трансляции: сродство кодонов к аминокислотам увеличивается от ранних к поздним кольцам РНК.

    Demongeot J, Селигманн Х.Demongeot J, et al. C R Biol. 2020 5 июня; 343 (1): 111-122. DOI: 10.5802 / crbiol.1. C R Biol. 2020. PMID: 32720493

  • Трансляция без AUG: новый старт для синтеза белка у эукариот.

    Кирс MG, Вилуш JE. Кирс М.Г. и др. Genes Dev. 2017 г. 1 сентября; 31 (17): 1717-1731. DOI: 10.1101 / gad.305250.117. Genes Dev. 2017 г. PMID: 28982758 Бесплатная статья PMC.Рассмотрение.

  • Создание разнообразия изоформ белка путем альтернативной инициации трансляции в кодонах, не относящихся к AUG.

    Touriol C, Bornes S, Bonnal S, Audigier S, Prats H, Prats AC, Vagner S. Touriol C, et al. Biol Cell. 2003 май-июнь; 95 (3-4): 169-78. DOI: 10.1016 / s0248-4900 (03) 00033-9. Biol Cell. 2003 г. PMID: 12867081 Рассмотрение.

Процитировано

2 статьи
  • Комбинаторные правила слияния для описания присвоения кодонов в стандартном генетическом коде.

    Нестеров-Мюллер А., Попов Р., Селигманн Х. Нестеров-Мюллер А. и др. Жизнь (Базель). 2020 Дек 23; 11 (1): 4. DOI: 10.3390 / life11010004. Жизнь (Базель). 2020. PMID: 33374866 Бесплатная статья PMC.

  • Следы единственного 22-нуклеотидного кольца РНК у истоков жизни.

    Демонжо Дж., Анрион-Код А. Demongeot J, et al. Биология (Базель).2020 Апрель 25; 9 (5): 88. DOI: 10.3390 / biology

    88. Биология (Базель). 2020. PMID: 32344921 Бесплатная статья PMC.

использованная литература

    1. A. Hecht, J. Glasgow, P. R. Jaschke, L. A. Bawazer, M. S. Munson, J. R. Cochran, D. Endy, M. Salit, Nucleic Acids Res. 2017, 1, 219.
    1. С.Bhattacharyya, U. Varshney, RNA Biol. 2016, 13, 810.
    1. А. Эльзановский, Дж. Остелл, https://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi (дата обращения: март 2020 г.).
    1. https: //biology.stackexchange.com/questions/9990/why-is-aug-the-initiati … (дата обращения: март 2020 г.).
    1. Дж.Demongeot, Revue de Biomaths 1978, 62, 61.

Показать все 94 ссылки

Условия MeSH

  • Кодон, инициатор / генетика
  • Биосинтез белков / генетика
Полнотекстовые ссылки [Икс] Wiley [Икс]

цитировать

Копировать

Формат: AMA APA ГНД NLM

Выберите стартовый кодон

Старт-кодоны


Гены бактерий состоят из нескольких компонентов.К ним относятся сигналы запуска и остановки, которые определяют начало и конец производимого белка. Эти сигналы представляют собой специфические кодоны или трехбуквенные комбинации нуклеотидных оснований, которые определяют МЕТ аминокислоты для начала и не определяют аминокислоту для остановки. Другой компонент гена, о котором вам нужно знать при назначении стартового кодона, — это так называемый сайт связывания рибосомы (RBS; также известный как последовательность шайна-дельгарно). Это серия нуклеотидов, расположенных на 7-13 оснований выше стартового кодона.Эта последовательность распознается рибосомой (белковым комплексом, который переводит информацию о последовательности мРНК в белок). Что делает RBS, так это сообщает рибосоме, где находится стартовый кодон, чтобы он знал, где начать производство белка. RBS указывает местоположение стартового кодона, поскольку он всегда находится только на небольшом расстоянии (7-13 нт) от правильного стартового кодона. Консенсусная последовательность сайтов связывания рибосом, которую мы будем использовать в этом проекте, взята из бактерии E. coli и составляет:

AGGAGGA

Существует множество разновидностей кодонов, которые могут использоваться в качестве стартовых кодонов у бактерий.Некоторые из них включают (ATG, TTG, GTG, CTG и т. Д.). Обратите внимание, что все они выглядят как ATG, который является наиболее распространенным и фактически указывает MET, в то время как некоторые другие обычно не делают. Однако ВСЕ они помещают аминокислоту МЕТ в первую позицию белка (на самом деле это модифицированная аминокислота МЕТ, связанная с формильной группой, которая отличает ее как начало). Важно отметить, что БОЛЬШИНСТВО стартовых кодонов — это ATG (> 90%), но можно использовать и другие варианты. К счастью, наша команда по биоинформатике уже проделала всю работу по их поиску.

Итак, как нам это сделать? Напомним, что мы используем пример Avi0017. После входа в систему перейдите по этой ссылке:

(http://agro.vbi.vt.edu/servlets-examples/servlet/GeneEdit?genename=avi0017&Search=Search&level=2)

Это приведет вас к записи, которую мы рассматриваем. Прокрутите немного вниз, чтобы увидеть окно, показывающее селектор стартовых кодонов. Это показывает последовательность ДНК гена Avi0017. На нем есть маленькие синие прямоугольники, которые указывают положения возможных стартовых кодонов, которые соответствуют рамке считывания этого гена (т.е. Если вы выберете их, порядок трех групп нуклеотидов [кодонов] для всего гена не изменится). Вы заметите, что под одним из синих прямоугольников есть красный прямоугольник, который близок к показанной последовательности ДНК. Это кодон, который в настоящее время выбран в качестве стартового кодона. Если вы хотите изменить это, просто щелкните любое другое синее поле, а затем нажмите кнопку «Отправить». Это изменит стартовый кодон на тот, который вы выбрали. Обратите внимание, что это также изменит аминокислотную последовательность белка, показанного двумя полями ниже.Это связано с тем, что стартовый кодон является первой аминокислотой, поэтому вы либо добавите (если вы переместитесь влево при выборе нового стартового кодона), либо удалите (если вы выберете одну справа) аминокислоты из белка.

Чтобы выбрать стартовый кодон, вам нужно сделать две вещи;

1. Посмотрите на различные варианты стартовых кодонов. Для каждого посмотрите вверх (слева) около 7-13 нуклеотидов (н.т.) и посмотрите, можете ли вы увидеть что-то похожее на консенсусный RBS (AGGAGGA).Обратите внимание, что это консенсус, что означает, что большинство сайтов связывания рибсом выглядят так, но могут быть вариации. В нашем гене Avi0017, если вы посмотрите перед выбранным стартовым кодоном, вы увидите последовательность:

 GTAACGAGGATAATGGAATG 

В этом примере я покрасил стартовый кодон в зеленый цвет, а RBS — в синий. Вы можете видеть, что это не точное совпадение (поскольку вторая буква — C, а не G), но оно очень близко. Не все будут так близко, но многие близки. Как и во всем остальном, если вы не уверены, ничего не меняйте.

2. Как только вы думаете, что нашли правильный старт, вам нужно посмотреть, как это соотносится с тем, что другие люди выбрали для аналогичных генов. Вы делаете это с помощью программы Blast, чтобы сравнить последовательность белка, который вы определили с помощью этого нового стартового кодона, с другими аналогичными белками в базе данных. Прямо над окном стартового кодона есть небольшая рамка с надписью:

Обработка на лету BLAST SIGNALP / SMART COG PFAM TMHMM PSORT

Щелкните ссылку BLAST, и откроется новое окно, содержащее измененную последовательность белка.Просто нажмите кнопку «поиск», чтобы запустить программу поиска совпадений. Через несколько секунд появятся результаты. Нажмите на верхнюю цветную полосу в списке, чтобы автоматически перейти к текстовым результатам ниже, или просто прокрутите список совпадений вниз. Вы должны увидеть что-то вроде этого:

> ссылка | NP_384131.1 | СОХРАНЕННЫЙ ГИПОТЕТИЧЕСКИЙ ТРАНСМЕМБРАННЫЙ БЕЛК [Sinorhizobium
meliloti 1021]
 emb | CAC41412.1 | СОХРАНЕННЫЙ ГИПОТЕТИЧЕСКИЙ ТРАНСМЕМБРАННЫЙ БЕЛК [Sinorhizobium
 meliloti]
 Длина = 141 
 Оценка = 169 бит (427), ожидание = 2e-41
   Идентичность = 80/134 (59%), Положительные = 100/134 (74%), Пробелы = 3/134 (2%) 
 Запрос: 1 MNQSALLRPGWRPATIAMMVLGFVIFWPLGLAMLAYILWGDRFRTSKRNANEAMDAMFSK 60
MNQSAL + RP W PATIA + MVLGF ++ FWPLGLAMLAYIL + GD + R K ++ ANE + D M
Sbjct: 1 MNQSALIRPDWTPATIALMVLGFIVFWPLGLAMLAYILFGDKLRAFKKDANEGVDRM --- 57 
 Запрос: 61 CCGXXXXXXXXXXXXXXXGNLAFDEWRVTELERIEQERRKLEEMREEFEAYVLELQRAKDQ 120
C G GN + AFD + WR EL R +++ ERRKL + EMREEF + YV EL + RAKDQ
Sbjct: 58 CAGFKRNRRGQWAHHRTGNVAFDDWRTAELARLDEERRKLDEMREEFDGYVRELRRAKDQ 117 
 Запрос: 121 DEFNRFMNQRNASR 134
+ EF + RFM + R R
Sbjct: 118 EEFDRFMRERKNGR 131 

Это показывает, как выравниваются два белка.Ваш белок — это «запрос», а его соответствие в базе данных — «тема». Обратите внимание, что следующий за «запросом:» — это номер 1. Это означает, что следующая за ним аминокислота является аминокислотой №1 в вашем белке. То же самое и в этом случае для запроса, он также показывает аминокислоту №1. Для нас это означает, что оба этих белка выбрали один и тот же стартовый кодон, поскольку выравнивание для каждого начинается с 1. Это означает, что для аналогичного белка из Sinorhizobium meliloti оба белка начинаются в одном и том же положении.

Вот пример того же поиска, в котором они не начинаются с одного и того же места:

> ссылка | ZP_00194050.2 | гипотетический белок MBNC02002869 [Mesorhizobium sp. BNC1]
 Длина = 155 
 Оценка = 161 бит (408), ожидание = 3e-39
   Идентичности = 77/131 (58%), положительные = 91/131 (69%), пробелы = 6/131 (4%) 
 Запрос: 1 MNQSALLRPGWRPATIAMMVLGFVIFWPLGLAMLAYILWGDRFRTSKRNANEAMDAMFSK 60
M SAL + RP W PATIA + MV + GF + FWPLGLAMLAYILWGDR KR N D + F +
Sbjct: 18 MTNSALIRPAWTPATIALMVIGFMAFWPLGLAMLAYILWGDRLHEFKRGINSKTDGLFAN 77 
 Запрос: 61 CCGXXXXXXXXXXXXXXXGNLAFDEWRVTELERIEQERRKLEEMREEFEAYVLELQRAKDQ 120
C GN + AFDEWR ELER + E + ERRKL + MR EF + YV EL + RAKDQ
Sbjct: 78 C ------ RRASRSYSMTGNIAFDEWRQKELERLEEERRKLDAMRSEFDEYVRELRRAKDQ 131 
 Запрос: 121 DEFNRFMNQRN 131
+ EF + RFM RN
Sbjct: 132 EEFDRFMRDRN 142 

В этом примере соответствующий белок из Mesorhizobium loti начинается на 18 аминокислот раньше, чем белок, который мы выбрали.В данном случае это связано с тем, что эта группа не тратила время на выбор стартовых кодонов, а просто использовала автоматизированные программы для поиска старта. Наша автоматизированная программа также нашла такое же начало до того, как мы его изменили, но это не был ATG (самый распространенный) и не имел RBS. Если вы быстро просмотрите остальные совпадения, вы увидите, что большинство из них используют выбранный нами стартовый кодон. Это то, что мы ищем. Если большинство используют другой, подумайте о внесении изменений, чтобы увидеть, есть ли у него лучшее RBS. Суть в том, что этот второй шаг является просто подтверждением: если вы очень уверены в своем RBS, придерживайтесь его, не меняйте только потому, что это сделали другие, если RBS не поддерживает изменение.

Вот и все, что нужно для идентификации сайта связывания рибосомы, довольно просто, да!


последнее обновление:

061753 04 декабря

Этот веб-сайт и его содержимое являются собственностью Вашингтонского университета. Авторское право 2004.

Вопросы и комментарии направляйте по адресу [email protected]

Дизайн и обслуживание сайта:

Дерек Вуд

Перевод — Обзор

Перевод — Обзор
Трансляция — это процесс создания белка (полипептидной цепи) из матрицы мРНК.
  • мРНК. МРНК содержит информацию, которая в конечном итоге будет переведена в белок. У прокариот мРНК может содержать несколько генов, у эукариот — только один ген.
  • тРНК. ТРНК будет обеспечивать включение различных аминокислот (а.о.) в белок.
  • рРНК. РРНК объединяется с несколькими ферментами с образованием рибосомы . Рибосома — это место, где происходит перевод, и различные ферменты помогают этому процессу.
  • Триплетное кодирование
    • Основания мРНК переводятся в аминокислоты по триплетам.
      • 20 аминокислот
      • 4 X 4 X 4 = 64 возможных сочетания оснований в кодонах
      • Код избыточен, некоторые аминокислоты кодируются несколькими кодонами.
      • AUG — единственный стартовый кодон
      • UAG, UGA и UAA — три стоп-кодона. Они сигнализируют о завершении процесса перевода.
    • Ген начинается со стартового кодона (AUG) и заканчивается одним из трех стоп-кодонов.
  • Расположение гена
    • Прокариоты: Последовательность Шайна-Далгарно сигнализирует рибосоме о том, что следующий AUG является стартовым кодоном для гена. Последовательность AUG без последовательности Шайна-Далгарно не начнет трансляцию. В одном транскрипте может быть несколько генов.
    • Эукариоты: с одного транскрипта транслируется единственная первичная полипептидная последовательность. Рибосома прикрепляется к Guanine-Cap и ищет оттуда правильный AUG.Точный процесс не понят, но практически всегда требует Guanine Cap. Это единственный белок, транслируемый с этой мРНК.
  • Обзор переводов
    • Трансляция начинается с AUG, определенного как стартовый кодон (см. Предыдущее обсуждение местоположения гена). Первая заряженная тРНК вводится у первой аминокислоты. У прокариот эта первая тРНК заряжена fMet, слегка модифицированным метионином (он формилирован). ТРНК также немного отличается от нормальной тРНК метионина.У эукариот эта первая тРНК заряжена нормальной версией метионина, но тРНК несколько отличается.
    • Вносится заряженная тРНК для следующего кодона. Первая аминокислота перемещается от своей тРНК к новой аминокислоте, и образуется пептидная связь.
    • Первая тРНК высвобождается, и рибосома перемещает один кодон вниз по мРНК, чтобы посмотреть на следующий кодон.
    • Эти два шага продолжаются до тех пор, пока появляется действительный кодон. В конце концов, этот кодон станет одним из трех стоп-кодонов.Когда это происходит, перевод прекращается; высвобождается полипептидная цепь (белок); и рибосома отделяется, позволяя ей прикрепиться к другому фрагменту мРНК.

Перевод — Биохимия

Если вы считаете, что контент, доступный через Веб-сайт (как определено в наших Условиях обслуживания), нарушает или другие ваши авторские права, сообщите нам, отправив письменное уведомление («Уведомление о нарушении»), содержащее в информацию, описанную ниже, назначенному ниже агенту.Если репетиторы университета предпримут действия в ответ на ан Уведомление о нарушении, оно предпримет добросовестную попытку связаться со стороной, которая предоставила такой контент средствами самого последнего адреса электронной почты, если таковой имеется, предоставленного такой стороной Varsity Tutors.

Ваше Уведомление о нарушении прав может быть отправлено стороне, предоставившей доступ к контенту, или третьим лицам, таким как в качестве ChillingEffects.org.

Обратите внимание, что вы будете нести ответственность за ущерб (включая расходы и гонорары адвокатам), если вы существенно искажать информацию о том, что продукт или действие нарушает ваши авторские права.Таким образом, если вы не уверены, что контент находится на Веб-сайте или по ссылке с него нарушает ваши авторские права, вам следует сначала обратиться к юристу.

Чтобы отправить уведомление, выполните следующие действия:

Вы должны включить следующее:

Физическая или электронная подпись правообладателя или лица, уполномоченного действовать от их имени; Идентификация авторских прав, которые, как утверждается, были нарушены; Описание характера и точного местонахождения контента, который, по вашему мнению, нарушает ваши авторские права, в \ достаточно подробностей, чтобы позволить репетиторам университетских школ найти и точно идентифицировать этот контент; например нам требуется а ссылка на конкретный вопрос (а не только на название вопроса), который содержит содержание и описание к какой конкретной части вопроса — изображению, ссылке, тексту и т. д. — относится ваша жалоба; Ваше имя, адрес, номер телефона и адрес электронной почты; а также Ваше заявление: (а) вы добросовестно считаете, что использование контента, который, по вашему мнению, нарушает ваши авторские права не разрешены законом, владельцем авторских прав или его агентом; (б) что все информация, содержащаяся в вашем Уведомлении о нарушении, является точной, и (c) под страхом наказания за лжесвидетельство, что вы либо владелец авторских прав, либо лицо, уполномоченное действовать от их имени.

Отправьте жалобу нашему уполномоченному агенту по адресу:

Чарльз Кон Varsity Tutors LLC
101 S. Hanley Rd, Suite 300
St. Louis, MO 63105

Или заполните форму ниже:

Инициирование синтеза белка

Инициирование синтеза белка

Аппарат синтеза белка должен выбрать подходящие отправные точки для считывания мРНК и образования пептидной связи.В качестве исходного кодона обычно используется AUG, и практически все белки начинаются с метионина. AUG также является кодоном для метионина, который также находится внутри белка, поэтому должен существовать механизм, позволяющий различать два типа кодонов метионина.

Этапы инициации происходят на изолированной малой субъединице (30S) прокариотической рибосомы. Рибосомы содержат две субъединицы, субъединицу 30S и 50S, которые связываются с образованием частицы 70S. (Значения S относятся к скорости, с которой каждый компонент осаждается в ультрацентрифуге; они не всегда складываются.В целом, субъединица 30S в основном участвует в процессе декодирования и взаимодействия тРНК-мРНК, в то время как субъединица 50S участвует в фактическом синтезе пептидных связей. Рибосомные субъединицы диссоциируют до реакции инициации.

Трансляция инициируется на 5′-конце мРНК. Поскольку РНК синтезируется в 5′-3′-направлении, бактериальная мРНК может начать трансляцию, пока 3′-последовательности еще транскрибируются. Это важно для нескольких форм биологического контроля.

Специальная инициаторная тРНК, тРНК met I (I означает инициатор), используется для начала синтеза белка.У бактерий эта инициаторная тРНК несет модифицированную аминокислоту N-формилметионин (fmet). Реакция формилирования переносит формильную группу от формил-тетрагидрофолата к метионил-тРНК met I + . Эта инициаторная тРНК используется для распознавания инициирующих кодонов; он не вставляет met в ответ на внутренний кодон AUG. В качестве дополнительной гарантии реакция формилирования гарантирует, что метионин-инициатор может находиться только на аминоконце синтезируемого белка.

Этап декодирования синтеза белка включает пар оснований между кодонами мРНК и антикодонными последовательностями тРНК.Дальнейшее событие спаривания оснований между некодирующими областями мРНК и рРНК необходимо для выбора правильной рамки считывания и инициирующего кодона. Бактериальные мРНК содержат богатую пуринами последовательность (называемую «Шайн-Дальгарно» или RBS , что является сокращением «Последовательность связывания рибосом») в 5′-нетранслируемой области мРНК. Эта последовательность комплементарна 3′-концу малой субъединицы рРНК, 16S рРНК. См. Рисунок 1.

Рисунок 1

После установления спаривания оснований синтез белка начинается с первого AUG ниже RBS.Эта особенность инициации используется как форма управления трансляцией. Информационные РНК с наибольшей степенью комплементарности RBS к 16S рРНК транслируются наиболее эффективно, по-видимому, потому, что они инициируют более эффективно.

Несколько белков факторов вовлечены в процесс инициации. Эти факторы обычно не входят в состав рибосомы; вместо этого они помогают сформировать активный комплекс инициации. Фактор инициации 3 (IF3) помогает удерживать субъединицу 30S, диссоциированную от субъединицы 50S и доступную для синтеза белка.IF1 связывается с изолированной 30S субъединицей и помогает образовывать комплекс между RBS и 16S рРНК. IF2 образует комплекс с fmet ‐ тРНК , met I и GTP, высвобождая IF3. После того, как комплекс содержит мРНК и инициатор fmet-тРНК, происходит следующее: GTP гидролизуется до GDP, факторы инициации высвобождаются из рибосомы, и субъединица 50S связывается с комплексом, образуя удлиненную рибосому, как показано на рисунке 2.


Рисунок 2

Синтез и созревание белка

Синтез и созревание белка

Синтез белка и созревание

Генетическая информация перетекает от ДНК к РНК к белку.ДНК кодирует информацию, необходимую для синтеза белков и копия закодированной информации транскрибируется и обрабатывается в информационную РНК (мРНК). Информация, переносимая мРНК, направляет синтез белков этот процесс называется трансляцией. Перевод происходит на поверхность частиц, называемых рибосомами.

Генетический Код

Генетический код — это система конкретные последовательности оснований, которые определяют, какие аминокислоты должны использоваться для синтез белка при трансляции.Генетический код состоит из кодоны, которые состоят из триплета оснований и определяют конкретную аминокислоту. Существует 64 последовательности кодонов, шестьдесят одна специфическая аминокислота и три прямые прекращение перевода. Поскольку существует 20 природных аминокислот, кислоты более одного кодона могут указывать на аминокислоту. Например, изолейцин определяется тремя кодонами AUU, AUC и AUA. Кодоны, указывающие то же самое аминокислоты называются синонимами. Генетический код называется вырожденным, потому что синонимичные кодоны обычно различаются только третьим основанием.Три кодона, UAA, UAG и UGA являются стоп-кодонами или бессмысленными кодонами и направляют прекращение трансляции.

Ала / А

GCU, GCC, GCA, GCG

Leu / L

UUA, UUG, CUU, CUC, CUA, CUG

Арг / R

CGU, CGC, CGA, CGG, AGA, AGG

Lys / K

AAA, AAG

Асн / №

AAU, AAC

Мет / М

AUG

Asp / D

GAU, GAC

Phe / F

UUU, UUC

Cys / C

УГУ, УГК

Pro / P

CCU, CCC, CCA, CCG

Gln / Q

CAA, CAG

Ser / S

UCU, UCC, UCA, UCG, AGU, AGC

клей / E

GAA, GAG

Thr / T

ACU, ACC, ACA, ACG

Gly / G

GGU, GGC, GGA, GGG

Trp / Вт

UGG

His / H

CAU, CAC

Tyr / Y

UAU, UAC

Иль / И

AUU, AUC, AUA

Val / V

ГУУ, ГУК, ГУА, ГУГ

СТАРТ

AUG

СТОП

UAA, UGA, UAG

Перевод обычно инициируется с кодоном AUG, который определяет метионин.Остальная часть сообщения читается последовательно, по одному кодону за раз, кодоны не перекрываются, перевод прекращается, когда встречается стоп-кодон.

Например, последовательность ДНК (смысловая цепь, которая транскрибируется напрямую) 5 ‘ ATGCCACCTATAGGGTAG 3 ‘сначала транскрибируется (просто заменяя тимин (T) на урацил (U)) в мРНК 5’ AUGCCACCUAUAGGGUAG 3 ‘. Затем эта мРНК транслируется в Met-Pro-Pro-Ile-Gly.

Аминокислотная активация

Аминокислоты должны быть активированы для перевод произойдет.Активация гарантирует, что правильная аминокислота будет признано, и что энергии достаточно для образования пептидной связи. Активация ковалентное связывание аминокислот с определенными адапторными молекулами. Адаптер молекулы называются транспортной РНК (тРНК). На каждый из 20 встречающихся в природе аминокислот. ТРНК распознает кодоны, несущие мРНК и расположите их так, чтобы облегчить образование пептидной связи.

Шаг 1

Аминокислота + АТФ ———-> Амино-AMP-enz + PPi; фермент: аминоацил тРНК синтаза

Амино связано через 5 ‘положение к рибозе на АТФ, высвобождая PPi.Обратите внимание, что комплекс амино-АМФ остается связаны с ферментом аминоацил тРНК-синтазой.

Шаг 2

Амино-AMP-enz + тРНК ———-> Амино-тРНК + AMP + фермент

Аминогруппа ферментативно переносится на 3′-концевой аденозин тРНК, высвобождая фермент и AMP.

Общее уравнение:

Амино кислота + АТФ + тРНК ———-> Амино-тРНК + АМФ + PPi

Обратите внимание: две высокоэнергетические фосфатные связи используются для образования амино-тРНК.Молекула тРНК, связанная с аминокислотой, называется заряженной.

Структура и функции тРНК

Все тРНК похожи по структуре. TyC рука участвует в связывании заряженной тРНК с участком на рибосоме, где происходит синтез белка. Рука DHU (или D) необходима для распознавания собственно аминоацил тРНК-синтаза (фермент). Конец акцептора находится на 3 ‘и оканчивается в последовательности CCA.Рука антикодона состоит из семи нуклеотидов, последовательность которых читается от 3 ‘до 5’ (соглашение, противоположное обычные 5 футов на 3 фута).

Каждый антикодон тРНК может иметь пару оснований с комплементарным кодоном на мРНК. Например, аргинин определяется двумя кодонами, AGA и AGG, но существует только один антикодон тРНК для Arg, 3 ‘UCU 5’. ТРНК распознает и пары оснований с любым из двух кодонов Arg. Спаривание оснований происходит между первые два основания кодона и антикодон, третье основание кодона не соответствует.Таким образом, спаривание оснований не является строгим для последнего нуклеотида кодон-антикодон, это явление называется колебанием.

Структура рибосомы

Рибосомы находятся в цитоплазме на внешней стороне грубый ER и в митохондриальном матриксе. Рибосомы состоят из РНК и белки. Коэффициент седиментации рибосом эукариот составляет 80S. В коэффициент седиментации S — это единица измерения, которая описывает, насколько быстро макромолекула осаждается при вращении в высокоскоростной центрифуге.Более крупные молекулы обычно имеют большие значения S. Рибосомы эукариот состоят из двух субъединиц: большая субъединица 60S и малая субъединица 40S. Субблок 60S состоит из около 45 белков и три рРНК, которые имеют S-коэффициенты 5, 5,8 и 28. Субъединица 40S состоит примерно из 33 белков и 18S рРНК.

Митохондриальные рибосомы состоят из большой субъединицы, 16S рРНК и малая субъединица 12S рРНК.

Синтез белка

Для трансляции мРНК в белок необходимы рибосомы, мРНК, тРНК, экзогенные белковые факторы и энергия в виде АТФ и ГТФ.Перевод происходит в три основных этапа: начало, удлинение и прекращение.

Начало

Для инициации трансляции необходимы четыре основных шага: рибосома диссоциация, образование преинициативного комплекса, образование инициации 40S комплекс и образование инициирующего комплекса 80S.

Удлинение

Во время элонгации белок синтезируется одной аминокислотой на время на рибосоме 80S.Этот процесс состоит из трех основных этапов: привязка заряженной тРНК, образование пептидной связи, транслокация растущего пептида цепь.

Прекращение действия

Когда появляется стоп-кодон, перевод завершается. Там нет тРНК, распознающих стоп-кодоны. Вместо белков, называемых высвобождением Факторы eRF распознают стоп-кодон. Релизинг-факторы вместе с пептидилом трансферазы и GTP катализируют гидролиз связи между полипептидом цепь и тРНК.Белок и тРНК отделяются от сайта и рибосома диссоциирует на субъединицы 40S и 60S, высвобождая мРНК.

Затраты энергии на синтез белка

Заряд тРНК: 2 АТФ

Связывание тРНК с рибосомой: 1 GTP

Транслокация: 1 GTP

Общая стоимость: 4 высокоэнергетические фосфатные связи для каждой образованной пептидной связи

Созревание белка

Скорость синтеза белка составляет около 6 пептидных связей в минуту, таким образом, синтез белка среднего размера занимает от 1 до 2 минут.Потому что мРНК часто имеет длину несколько тысяч нуклеотидов, одни и те же молекулы мРНК могут одновременно связываться с множеством рибосом. МРНК, которая связана несколькими рибосомы называют полисомами. Полисомы обеспечивают механизм для многих копий белка, транслируемого с одной мРНК. Полисомы в цитозоле синтезируют большинство белков и ферментов, необходимых организму для внутриклеточных процессов например, метаболизм.

Когда синтез белка прекращается, аминокислота-инициатор, метионин, будет иметь свободную аминогруппу.Этот конец белка является N-концом и последняя аминокислота в цепи имеет свободный карбокси или С-конец. Синтез белка таким образом, инициируется с аминоконца и продвигается к С-концу. Белки, синтезированные на грубом ЭПР, транспортируются через мембрану в цистернальные пространства между листами ER, где они упакованы для экспорт. Чтобы транспортироваться через мембрану, белок синтезируется с сигнальная или лидерная последовательность на его амино-конце.

После его синтеза образуются дисульфидные связи и белок складывается в трехмерное состояние. Некоторые белки требуют посттрансляционного модификация, прежде чем стать полностью активным. Эти модификации могут включать удаление сегментов с использованием пептидаз, добавления фосфата, сахара или липидов к специфическим аминокислоты и гликозилирование.

Белок Синтез Анимация

Ингибиторы трансляции

Антибиотики

Стрептомицин: предотвращает связывание тРНК, тем самым блокируя инициацию перевода.

Эритромицин: связывается с субъединицей 50S прокариотической рибосомы, блокирование транслокации.

Тетрациклин: связывается с 30S субъединицей прокариотической рибосомы. и ингибирует связывание заряженной тРНК.

Токсины

Диптерия: катализирует ADP-рибозилирование His при ингибировании eEF транслокация.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *